DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Lrrc4

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_619623.2 Gene:Lrrc4 / 192198 MGIID:2182081 Length:652 Species:Mus musculus


Alignment Length:651 Identity:132/651 - (20%)
Similarity:227/651 - (34%) Gaps:223/651 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KIYCLALIFRSASADWLLDCGN-CHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFY 86
            :::.|.....:|::....:|.: |.|. |...|.. |....||.||:.:....:.|:|..|:|..
Mouse    26 QVWILCAAIAAAASAGPQNCPSVCSCS-NQFSKVV-CTRRGLSEVPQGIPSNTRYLNLMENNIQM 88

  Fly    87 LEENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAI 151
            ::.:.|  .||.:|:.|.:...:::.:...:|..|..|..|:|.:|.|..:....|:.|||:|.:
Mouse    89 IQADTF--RHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLREL 151

  Fly   152 FLNGN-------------------------LLQALRHGVFR---NLKYLH--------------- 173
            :|..|                         .|:.:..|.|.   |||||:               
Mouse   152 WLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPL 216

  Fly   174 ----------------------------KIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLR 210
                                        |:.:..:::..|:..||.|:..|.::.|.:|.|:.|.
Mouse   217 VGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLP 281

  Fly   211 VESFQDLTKLTALSLVENPWNCTCDL----QMFRDFVIGMNLYTPPTS------CHYPLQLRGRL 265
            .:.|..|..|..|.|..|||||.||:    ...|:::        ||:      ||.|:.:|||.
Mouse   282 HDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYI--------PTNSTCCGRCHAPMHMRGRY 338

  Fly   266 WIEDQPEAFACKPKIVYPTLSTSINTSKENVT-LICRVHGSPNTVIAWDYTNQVYESRSKPVKSL 329
            .:|....||.|....:... ...:|.|::.:. |.||.  .|.:.:.|...|..       |.|.
Mouse   339 LVEVDQAAFQCSAPFIMDA-PRDLNISEDRMAELKCRT--PPMSSVKWLLPNGT-------VLSH 393

  Fly   330 QKQRIYIELLREDESKIRKFGHDVFVSRLTIVNARKSDEGVYTCLAENPGGK------------- 381
            ..:...|.:|.:.....         ||:.::     |.|||||:..|..|.             
Mouse   394 ASRHPRISVLNDGTLNF---------SRVLLI-----DTGVYTCMVTNVAGNSNASAYLNVSSAE 444

  Fly   382 --------------DSVHIS---------------------------VVVQ-------------- 391
                          ::..||                           |::|              
Mouse   445 LNTPNFSFFTTVTVETTEISPEDITRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVPVPSTD 509

  Fly   392 -KDMERISL---IDSNFFAIVCLIAMGFLSMSILFSLVTCLIFKRFKQFHPGQHTYLQPTS---- 448
             .|..:.||   :.:....|.|.:|:..|:.::|      ::|.:.::.|..:.|.....:    
Mouse   510 TTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAML------IVFYKLRKRHQQRSTVTAARTVEII 568

  Fly   449 -----LPVQSPGSEEATAISALSSGVIRESKIVLDPLSAINEPSNKNYTLFK-------TSNSNG 501
                 :|..:|     .|.:|..|||..|..:||..:.     .:.||..:|       |.||.|
Mouse   569 QVDEDIPAAAP-----AAATAAPSGVSGEGAVVLPTIH-----DHINYNTYKPAHGAHWTENSLG 623

  Fly   502 S 502
            :
Mouse   624 N 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 7/23 (30%)
LRR_8 99..158 CDD:290566 16/83 (19%)
leucine-rich repeat 100..123 CDD:275380 4/22 (18%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
LRR_8 146..206 CDD:290566 21/130 (16%)
leucine-rich repeat 148..171 CDD:275380 8/50 (16%)
leucine-rich repeat 172..195 CDD:275380 6/65 (9%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
TPKR_C2 228..277 CDD:301599 19/58 (33%)
IG_like 294..390 CDD:214653 23/150 (15%)
Ig 296..387 CDD:143165 20/118 (17%)
Lrrc4NP_619623.2 LRRNT 45..78 CDD:214470 10/34 (29%)
LRR_8 74..132 CDD:290566 14/59 (24%)
LRR 1 75..96 5/22 (23%)
leucine-rich repeat 76..99 CDD:275380 7/24 (29%)
LRR_RI 91..304 CDD:238064 46/214 (21%)
LRR 2 99..120 3/20 (15%)
leucine-rich repeat 100..123 CDD:275380 4/22 (18%)
LRR 3 123..144 6/20 (30%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
LRR_8 146..207 CDD:290566 13/60 (22%)
LRR 4 147..168 4/20 (20%)
leucine-rich repeat 148..171 CDD:275380 3/22 (14%)
LRR 5 171..193 3/21 (14%)
leucine-rich repeat 172..196 CDD:275380 3/23 (13%)
LRR 6 196..217 5/20 (25%)
leucine-rich repeat 197..218 CDD:275380 4/20 (20%)
LRR_8 218..277 CDD:290566 8/58 (14%)
LRR 7 218..239 0/20 (0%)
leucine-rich repeat 219..242 CDD:275380 0/22 (0%)
LRR 8 242..263 4/20 (20%)
leucine-rich repeat 243..266 CDD:275380 5/22 (23%)
LRR 9 266..287 6/20 (30%)
leucine-rich repeat 267..288 CDD:275380 6/20 (30%)
LRRCT 299..350 CDD:214507 19/58 (33%)
IG_like 358..440 CDD:214653 22/104 (21%)
Ig 369..440 CDD:299845 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8825
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.