Sequence 1: | NP_001260435.1 | Gene: | kek4 / 34718 | FlyBaseID: | FBgn0032484 | Length: | 649 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505188.3 | Gene: | pxn-1 / 191484 | WormBaseID: | WBGene00004256 | Length: | 1285 | Species: | Caenorhabditis elegans |
Alignment Length: | 529 | Identity: | 104/529 - (19%) |
---|---|---|---|
Similarity: | 162/529 - (30%) | Gaps: | 197/529 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 IYCLALIFRSASADWLLDCG-NCHCKWNSGKK--TADCRNLSLSGVPEYLSPEVQVLDLSHNHIF 85
Fly 86 YLEENAFLTTHLQNLQKLLIRNG---TLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSK 147
Fly 148 VRAIFLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVE 212
Fly 213 SFQDLTKLTALSLVENPWNCTCDLQMFRDFVIGMNLYTPPTSCHYPLQLRGRLWIEDQPEAFAC- 276
Fly 277 ----------------------------------------------------------------- 276
Fly 277 -------------------KPKIVYPTLSTSINTSKENVTLICRVHGSPNTVIAWDYTNQVYESR 322
Fly 323 SKPVKSLQKQ--RIYIELLREDE-----------SKIRKF------------------------- 349
Fly 350 GHDVFV---------------------------------SRLTIVNARKSDEGVYTCLAENPGGK 381
Fly 382 DSVHISVVV 390 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek4 | NP_001260435.1 | leucine-rich repeat | 75..99 | CDD:275380 | 0/23 (0%) |
LRR_8 | 99..158 | CDD:290566 | 19/61 (31%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 9/25 (36%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 146..206 | CDD:290566 | 14/59 (24%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 7/22 (32%) | ||
TPKR_C2 | 228..277 | CDD:301599 | 12/133 (9%) | ||
IG_like | 294..390 | CDD:214653 | 37/166 (22%) | ||
Ig | 296..387 | CDD:143165 | 36/161 (22%) | ||
pxn-1 | NP_505188.3 | LRRNT | 23..51 | CDD:279764 | 7/27 (26%) |
leucine-rich repeat | 35..53 | CDD:275380 | 5/43 (12%) | ||
LRR_8 | 52..112 | CDD:290566 | 19/62 (31%) | ||
LRR_4 | 53..93 | CDD:289563 | 13/42 (31%) | ||
leucine-rich repeat | 54..77 | CDD:275380 | 7/22 (32%) | ||
LRR_4 | 77..120 | CDD:289563 | 12/46 (26%) | ||
leucine-rich repeat | 78..101 | CDD:275380 | 8/25 (32%) | ||
leucine-rich repeat | 102..117 | CDD:275380 | 3/15 (20%) | ||
LRR_8 | 123..182 | CDD:290566 | 17/58 (29%) | ||
leucine-rich repeat | 125..148 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 7/22 (32%) | ||
I-set | 315..400 | CDD:254352 | 22/86 (26%) | ||
IGc2 | 328..392 | CDD:197706 | 17/65 (26%) | ||
IG_like | 414..496 | CDD:214653 | 18/81 (22%) | ||
Ig | 420..496 | CDD:299845 | 18/75 (24%) | ||
An_peroxidase | 634..1181 | CDD:281139 | |||
peroxidasin_like | 757..1203 | CDD:188658 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |