DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and lrg1

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_004911101.1 Gene:lrg1 / 116406453 XenbaseID:XB-GENE-984373 Length:372 Species:Xenopus tropicalis


Alignment Length:326 Identity:71/326 - (21%)
Similarity:118/326 - (36%) Gaps:88/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FLFKIYCLALIFRSASADWLLDCGN-CHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNH 83
            |:|    :.:||..::......|.: |:|. :|...:..|.:..|...|.........:.:...:
 Frog    43 FIF----VVVIFIPSALGLTDPCPSLCNCT-SSLNISVVCISRELDSFPCSFPLHTISISVEFTN 102

  Fly    84 IFYLEENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKV 148
            |..|...:|  :.|.|||:|.:.|..|:.|..:.|..|..|..|||:|||:..:.|.:|..:..:
 Frog   103 ITSLCNGSF--SELPNLQELHLSNNALQSLPIQFFVPLSSLHTLDLTNNLIQSVTPTLFLDVPAL 165

  Fly   149 RAIFLNGNLLQAL---RHGVFRNLKY---------------------LHKIELKRNRLVSIDAKA 189
            |.:.|.||||..|   :..:.:||.:                     |..::|..|:|..:.:..
 Frog   166 RFLVLRGNLLTKLWISKISILKNLNWLDLSHNHLKEVNSMSFSSLNNLENLDLSYNQLHQLPSSL 230

  Fly   190 FVGVPLLSQIYLDNNELTKLRVESFQ--------------------------------DLTK--- 219
            ..|:|||.::.|:.|.|:.|..:.|.                                ||::   
 Frog   231 LKGLPLLQRLNLEGNNLSSLPSDFFAATPFLKHVFLARNSLHFLPKGLLLPVMSLKTLDLSENML 295

  Fly   220 ------------------LTALSLVENPWNCTCDLQMFRDFVIGMN---LYTPPTSCHYPLQLRG 263
                              ...|.|..|||:|.|.|.....:|....   .:...|.|..|..|:.
 Frog   296 KSLPSGFLLESKGLNDSMEQTLDLSNNPWHCDCHLLSLHQWVTKHKHTLYFIDNTQCAGPGALKN 360

  Fly   264 R 264
            |
 Frog   361 R 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 50/245 (20%)
leucine-rich repeat 75..99 CDD:275380 4/23 (17%)
LRR_8 98..158 CDD:404697 22/59 (37%)
leucine-rich repeat 100..123 CDD:275380 8/22 (36%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
leucine-rich repeat 148..171 CDD:275380 9/25 (36%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
leucine-rich repeat 196..219 CDD:275380 8/54 (15%)
LRRCT 228..277 CDD:214507 12/40 (30%)
IG_like 294..390 CDD:214653
Ig strand B 296..300 CDD:409353
Ig strand C 309..323 CDD:409353
Ig strand E 356..360 CDD:409353
Ig strand F 370..375 CDD:409353
Ig strand G 383..386 CDD:409353
lrg1XP_004911101.1 LRR <107..363 CDD:443914 58/257 (23%)
leucine-rich repeat 117..140 CDD:275380 8/22 (36%)
leucine-rich repeat 141..164 CDD:275380 9/22 (41%)
leucine-rich repeat 165..188 CDD:275380 7/22 (32%)
leucine-rich repeat 189..212 CDD:275380 1/22 (5%)
leucine-rich repeat 213..236 CDD:275380 5/22 (23%)
leucine-rich repeat 237..260 CDD:275380 6/22 (27%)
leucine-rich repeat 261..284 CDD:275380 0/22 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.