DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and LRRN2

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_006329.2 Gene:LRRN2 / 10446 HGNCID:16914 Length:713 Species:Homo sapiens


Alignment Length:514 Identity:118/514 - (22%)
Similarity:179/514 - (34%) Gaps:185/514 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WLLDC-GNCHCK---WNSGKK------TADCRNLSLSGVPEYLSPEVQV---------------- 76
            |.:.| ..|.|:   |.:.:.      |.||.:|.|:.||..|....|.                
Human    25 WHVPCPPQCACQIRPWYTPRSSYREATTVDCNDLFLTAVPPALPAGTQTLLLQSNSIVRVDQSEL 89

  Fly    77 --------LDLSHNHI----------------FYLEENAF--LTTH----LQNLQKLLIRNGTLK 111
                    ||||.|..                .:||||..  |..|    |.:||:|.:.:..|.
Human    90 GYLANLTELDLSQNSFSDARDCDFHALPQLLSLHLEENQLTRLEDHSFAGLASLQELYLNHNQLY 154

  Fly   112 YLNQRSFTQLQILIELDLSNNLL-------VDLLPNV-----------------FDCLSKVRAIF 152
            .:..|:|:.|..|:.|.|::|||       .::|||:                 |..|:.:|::.
Human   155 RIAPRAFSGLSNLLRLHLNSNLLRAIDSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSLV 219

  Fly   153 ------------------------------------------------LNGNLLQALRHGVFRNL 169
                                                            ||.|.||.:..|.|.|:
Human   220 LAGMNLREISDYALEGLQSLESLSFYDNQLARVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANM 284

  Fly   170 KYLHKIELKR-NRLVSIDAKAFVGVPLLSQ-------------------------IYLDNNELTK 208
            .:|.::.|.. ..|||||..|.|.:|.|::                         :.|:||.|:.
Human   285 LHLKELGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSFIHPRAFHHLPQMETLMLNNNALSA 349

  Fly   209 LRVESFQDLTKLTALSLVENPWNCTCDLQMFRDFVIGMNLYTP-PTSCHYPLQLRGRLWIEDQPE 272
            |..::.:.|..|..:.|..||..|.|.::........:....| .|.|..|..|: ||.:.:.| 
Human   350 LHQQTVESLPNLQEVGLHGNPIRCDCVIRWANATGTRVRFIEPQSTLCAEPPDLQ-RLPVREVP- 412

  Fly   273 AFA-----CKPKIVYPTLSTSIN-TSKENVTLICRVHGSPNTVIAWDYTNQVYESRSKPVKSLQK 331
             |.     |.|.|...:...|:. .|.|::.|.||....|...|.|.....:   |..|..:.::
Human   413 -FREMTDHCLPLISPRSFPPSLQVASGESMVLHCRALAEPEPEIYWVTPAGL---RLTPAHAGRR 473

  Fly   332 QRIYIELLREDESKIRKFGHDVFVSRLTIVNARKSDEGVYTCLAENPGGKDSVHISVVV 390
            .|:|.|...|             :.|:|...|     |:|||:|:|..|.|:..:||||
Human   474 YRVYPEGTLE-------------LRRVTAEEA-----GLYTCVAQNLVGADTKTVSVVV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 13/69 (19%)
LRR_8 99..158 CDD:290566 22/130 (17%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
leucine-rich repeat 124..147 CDD:275380 11/46 (24%)
LRR_8 146..206 CDD:290566 23/133 (17%)
leucine-rich repeat 148..171 CDD:275380 9/70 (13%)
leucine-rich repeat 172..195 CDD:275380 9/23 (39%)
leucine-rich repeat 196..219 CDD:275380 7/47 (15%)
TPKR_C2 228..277 CDD:301599 13/54 (24%)
IG_like 294..390 CDD:214653 26/95 (27%)
Ig 296..387 CDD:143165 23/90 (26%)
LRRN2NP_006329.2 leucine-rich repeat 51..69 CDD:275380 8/17 (47%)
LRR_RI 62..288 CDD:238064 43/225 (19%)
LRR 1 70..91 1/20 (5%)
leucine-rich repeat 71..94 CDD:275380 1/22 (5%)
LRR 2 94..115 5/20 (25%)
leucine-rich repeat 95..118 CDD:275380 5/22 (23%)
LRR_8 117..177 CDD:290566 18/59 (31%)
LRR 3 118..139 6/20 (30%)
leucine-rich repeat 119..142 CDD:275380 7/22 (32%)
LRR 4 142..163 6/20 (30%)
leucine-rich repeat 143..166 CDD:275380 7/22 (32%)
LRR_8 165..222 CDD:290566 12/56 (21%)
LRR 5 166..187 6/20 (30%)
leucine-rich repeat 167..190 CDD:275380 7/22 (32%)
LRR 6 190..211 2/20 (10%)
leucine-rich repeat 191..214 CDD:275380 2/22 (9%)
LRR_RI 209..>372 CDD:238064 32/162 (20%)
LRR_8 214..273 CDD:290566 4/58 (7%)
LRR 7 214..235 1/20 (5%)
leucine-rich repeat 215..238 CDD:275380 1/22 (5%)
LRR 8 238..259 0/20 (0%)
leucine-rich repeat 239..262 CDD:275380 0/22 (0%)
LRR 9 262..283 7/20 (35%)
leucine-rich repeat 263..286 CDD:275380 8/22 (36%)
LRR 10 286..305 7/18 (39%)
leucine-rich repeat 287..311 CDD:275380 9/23 (39%)
LRR_8 310..371 CDD:290566 11/60 (18%)
LRR 11 311..333 1/21 (5%)
leucine-rich repeat 312..334 CDD:275380 1/21 (5%)
LRR 12 336..357 5/20 (25%)
leucine-rich repeat 337..360 CDD:275378 6/22 (27%)
leucine-rich repeat 361..373 CDD:275378 4/11 (36%)
TPKR_C2 369..412 CDD:301599 11/43 (26%)
I-set 430..514 CDD:254352 28/104 (27%)
Ig 438..514 CDD:299845 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.