| Sequence 1: | NP_001260435.1 | Gene: | kek4 / 34718 | FlyBaseID: | FBgn0032484 | Length: | 649 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005163128.1 | Gene: | lrrn3a / 101887059 | ZFINID: | ZDB-GENE-061220-7 | Length: | 691 | Species: | Danio rerio |
| Alignment Length: | 529 | Identity: | 116/529 - (21%) |
|---|---|---|---|
| Similarity: | 172/529 - (32%) | Gaps: | 194/529 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 27 LALIFRSASADWLLDCGN-CHCK---WNS------GKKTADCRNLSLSGVPEYLSPEVQVL---- 77
Fly 78 -------------------DLSHNHI----------------FYLEEN-------AFLTTHLQNL 100
Fly 101 QKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNGNLLQALRHGV 165
Fly 166 F---------------------------------------------------RNLKYL------- 172
Fly 173 ------------HKIELKRN---RLVSIDA-------------------------KAFVGVPLLS 197
Fly 198 QIYLDNNELTKLRVESFQDLTKLTALSLVENPWNCTCDLQMFRDFVIGMN------LYTPPTSCH 256
Fly 257 YPLQLRGRL--WIEDQPEAFACKPKIVYPTLSTSINTSKEN-VTLICRVHGSPNTVIAWDYTNQV 318
Fly 319 YESRSK--PVKSLQKQRIYIELLREDESKIRKFGHDVFVSRLTIVNARKSDEGVYTCLAENPGGK 381
Fly 382 DSVHISVVV 390 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek4 | NP_001260435.1 | leucine-rich repeat | 75..99 | CDD:275380 | 15/69 (22%) |
| LRR_8 | 99..158 | CDD:290566 | 16/58 (28%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 146..206 | CDD:290566 | 23/157 (15%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 5/73 (7%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 12/69 (17%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 6/22 (27%) | ||
| TPKR_C2 | 228..277 | CDD:301599 | 13/56 (23%) | ||
| IG_like | 294..390 | CDD:214653 | 23/98 (23%) | ||
| Ig | 296..387 | CDD:143165 | 22/92 (24%) | ||
| lrrn3a | XP_005163128.1 | LRR_RI | 29..>272 | CDD:238064 | 50/243 (21%) |
| leucine-rich repeat | 52..70 | CDD:275380 | 8/17 (47%) | ||
| leucine-rich repeat | 71..93 | CDD:275380 | 3/21 (14%) | ||
| leucine-rich repeat | 94..117 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 118..141 | CDD:275380 | 7/23 (30%) | ||
| LRR_8 | 140..200 | CDD:290566 | 16/59 (27%) | ||
| leucine-rich repeat | 142..165 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 166..189 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 190..213 | CDD:275380 | 2/22 (9%) | ||
| LRR_8 | 213..272 | CDD:290566 | 5/58 (9%) | ||
| leucine-rich repeat | 214..237 | CDD:275380 | 0/22 (0%) | ||
| leucine-rich repeat | 238..261 | CDD:275380 | 0/22 (0%) | ||
| leucine-rich repeat | 262..285 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 286..310 | CDD:275380 | 8/23 (35%) | ||
| LRR_8 | 309..370 | CDD:290566 | 12/60 (20%) | ||
| leucine-rich repeat | 311..333 | CDD:275380 | 2/21 (10%) | ||
| leucine-rich repeat | 336..359 | CDD:275378 | 6/22 (27%) | ||
| leucine-rich repeat | 360..372 | CDD:275378 | 4/11 (36%) | ||
| LRRCT | 368..412 | CDD:214507 | 12/48 (25%) | ||
| IG_like | 429..513 | CDD:214653 | 24/106 (23%) | ||
| Ig | 437..513 | CDD:299845 | 23/98 (23%) | ||
| FN3 | 526..>591 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | mtm6470 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||