DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Islr2

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001386356.1 Gene:Islr2 / 100910729 RGDID:6497037 Length:746 Species:Rattus norvegicus


Alignment Length:439 Identity:99/439 - (22%)
Similarity:144/439 - (32%) Gaps:139/439 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FKIYCLALIFRSASADWLL-----DCGN-CHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLS 80
            |...|||         |.|     .|.. |.|......:.|||....|..|||.|...|..|.||
  Rat     5 FGSLCLA---------WALLGVARACPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLS 60

  Fly    81 HNHIFYLEENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCL 145
            .|.|..|...||:  ::..:..|.:.:..::.:...:...|..|..||||:||:.:         
  Rat    61 ANKITVLRRGAFV--NVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHNLISN--------- 114

  Fly   146 SKVRAIFLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLR 210
                  |...:|         |||..|..:::..|||.|:...|...:|.|..:.::||.|..|.
  Rat   115 ------FPWSDL---------RNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLE 164

  Fly   211 VESFQDLTKLTALSLVENPWNCTCDLQMFRDFVIGMNLYTP-PTS--CHYPLQLRG----RLWIE 268
            ..:|..|:.|:.|.|..||::|:|.|...:.:.....:..| |.|  |..|.:|:|    ||   
  Rat   165 PGTFDALSALSHLQLYHNPFHCSCGLVWLQAWAASTRVSLPEPDSIACASPPELQGVPVHRL--- 226

  Fly   269 DQPEAFACKPKIVYPTLSTSINTSKE----------NVTLICRVHGSPNTVIAW----------- 312
               .|..|.|    |::..|.....|          :..|.|...|.|...:.|           
  Rat   227 ---PALPCAP----PSVRLSAEPPPEAPGTPLRAGLSFLLHCVAEGHPTPRLQWQLQIPGGTVVL 284

  Fly   313 ------------------------DYTNQVYESRSKPVK------------SLQKQRIYIELLRE 341
                                    |...|.......|..            :|....:.:.||..
  Rat   285 VPPVLSKEEDGGEKVDDGEGDGDEDQPTQTEAPTPTPAPAWPAPPATPRFLALANGSLLVPLLSA 349

  Fly   342 DESKIRKFGHDVFVSRLTIVNARKSDEGVYTCLAENPGGKDSVHISVVV 390
            .|:                        |:|||.|.|..|.:|..:.|.|
  Rat   350 KEA------------------------GIYTCRAHNELGTNSTSLRVTV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 45/168 (27%)
leucine-rich repeat 75..99 CDD:275380 8/23 (35%)
LRR_8 98..158 CDD:404697 10/59 (17%)
leucine-rich repeat 100..123 CDD:275380 2/22 (9%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
LRRCT 228..277 CDD:214507 15/55 (27%)
IG_like 294..390 CDD:214653 22/152 (14%)
Ig strand B 296..300 CDD:409353 1/3 (33%)
Ig strand C 309..323 CDD:409353 3/48 (6%)
Ig strand E 356..360 CDD:409353 0/3 (0%)
Ig strand F 370..375 CDD:409353 3/4 (75%)
Ig strand G 383..386 CDD:409353 1/2 (50%)
Islr2NP_001386356.1 leucine-rich repeat 37..53 CDD:275380 7/15 (47%)
LRR <52..>184 CDD:443914 41/157 (26%)
leucine-rich repeat 54..77 CDD:275380 9/24 (38%)
leucine-rich repeat 78..101 CDD:275380 2/22 (9%)
leucine-rich repeat 102..125 CDD:275380 12/46 (26%)
leucine-rich repeat 126..149 CDD:275380 6/22 (27%)
leucine-rich repeat 150..173 CDD:275380 7/22 (32%)
PCC 155..>229 CDD:188093 23/79 (29%)
Ig 249..374 CDD:472250 21/148 (14%)
Ig strand B 257..261 CDD:409353 1/3 (33%)
Ig strand C 270..277 CDD:409353 1/6 (17%)
Ig strand E 340..344 CDD:409353 0/3 (0%)
Ig strand F 354..359 CDD:409353 3/4 (75%)
Ig strand G 367..370 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.