DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Tpbgl

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001182458.1 Gene:Tpbgl / 100503386 MGIID:3646425 Length:384 Species:Mus musculus


Alignment Length:253 Identity:62/253 - (24%)
Similarity:94/253 - (37%) Gaps:67/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PCSISLKHLSLFLFKIYCLA---LIFRSASADWLLDCGNCHCKWNSGKKTADCRNLSLSG----- 65
            ||.          |:.||..   |:.|.||        ....:........|.|||::.|     
Mouse    30 PCP----------FQCYCFGSPRLMLRCAS--------GAELRQPPRDVPPDARNLTIVGANLTV 76

  Fly    66 -------------VPEYLSPEVQVLDLSHNHIFYLEENAFLTTHLQNLQKLLIRNGTLKYLNQRS 117
                         ......|.:..|.|:||:|..:|:.||  ..|.:|..|.:.:..|:.|..|:
Mouse    77 LRAAAFAGGGEGATDGVRLPLLTALRLTHNNIEVVEDGAF--DGLPSLAALDLSHNPLRALGYRA 139

  Fly   118 FTQLQILIELDLSNNL------LVDLLPNVFDCLSKVRAIFLNGNLLQALRHGVFRNLKYLHKIE 176
            |..|..|..|.|::.|      ::|.|......|:::|.:.|.||.|..|.....| |..|.:::
Mouse   140 FRGLPALRSLQLNHALARGSPGMLDALDAALAPLAELRLLGLVGNALSRLPLAALR-LPRLEQLD 203

  Fly   177 LKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVENPWNCTC 234
            .:.|.|..                |..:||:.|  |...||.: ..|.|.:||.:|.|
Mouse   204 ARVNALAG----------------LGPDELSAL--ERDGDLPQ-PRLLLADNPLSCGC 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 48/192 (25%)
leucine-rich repeat 75..99 CDD:275380 9/23 (39%)
LRR_8 98..158 CDD:404697 18/65 (28%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
leucine-rich repeat 124..147 CDD:275380 7/28 (25%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
leucine-rich repeat 172..195 CDD:275380 3/22 (14%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
LRRCT 228..277 CDD:214507 4/7 (57%)
IG_like 294..390 CDD:214653
Ig strand B 296..300 CDD:409353
Ig strand C 309..323 CDD:409353
Ig strand E 356..360 CDD:409353
Ig strand F 370..375 CDD:409353
Ig strand G 383..386 CDD:409353
TpbglNP_001182458.1 LRR 1 61..84 5/22 (23%)
LRR <94..>239 CDD:443914 46/166 (28%)
LRR 2 95..118 9/24 (38%)
LRR_8 96..153 CDD:404697 20/58 (34%)
leucine-rich repeat 98..121 CDD:275378 9/24 (38%)
LRR 3 119..142 7/22 (32%)
leucine-rich repeat 122..145 CDD:275378 7/22 (32%)
leucine-rich repeat 146..198 CDD:275378 15/52 (29%)
LRR 4 173..196 8/23 (35%)
LRR 5 198..219 6/36 (17%)
leucine-rich repeat 199..219 CDD:275378 6/35 (17%)
leucine-rich repeat 220..240 CDD:275378 8/22 (36%)
LRRCT 236..288 CDD:214507 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..384
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.