DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15482 and CG11227

DIOPT Version :9

Sequence 1:NP_609614.2 Gene:CG15482 / 34717 FlyBaseID:FBgn0032483 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_728371.1 Gene:CG11227 / 33071 FlyBaseID:FBgn0031139 Length:764 Species:Drosophila melanogaster


Alignment Length:272 Identity:61/272 - (22%)
Similarity:103/272 - (37%) Gaps:73/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LQEMQDLLYTKHFSNYRLPASVAAPAPEDQLLLKLQNFESLTEQPSSSRKSTATTSSDSPWSRLR 103
            |....|..|.:||...|:|.                             |...|.|..       
  Fly   522 LHATSDHEYRQHFRKQRIPF-----------------------------KKVLTNSVQ------- 550

  Fly   104 LVACPCHGCLC-SVDPSALLGHYLSDHLPGMGVPFYELEMGKRVSLTCHISSLERDVNTLLGVYG 167
             .|||.:...| :|....||.|::|.||...|....|:..|:::.:.....:.:......:.|.|
  Fly   551 -YACPLNNDECPAVMNDTLLAHFVSRHLDEPGKELREIFEGEQMLMIFSPRAFQLAKTECISVLG 614

  Fly   168 YR------------RTGLNPLKCHRNTHLPVEYRRFSQHSALMIFACRT-MHSVLWERKRVK--- 216
            |.            |..|.|     |:.||..|..|..|..|::..||. |.:|...::|.:   
  Fly   615 YGGVRNKPCTLPAVRFMLTP-----NSGLPEAYDHFDGHLPLLVMICRNPMGTVEGRKERFEGLE 674

  Fly   217 -HEVLAIWVAT-----PLHGVAITLRLLVQPANLPRYYTRQIKARPMLPLSSNQSCSEFIKTDSN 275
             .:.||:|:.:     |:| ||:|  :|.:..::.|....:::.     |..:|...:|:.::.|
  Fly   675 DEDTLALWMVSRDLPCPIH-VAMT--VLSRRLDITRSSIMKVRG-----LHKSQDPLDFMLSNKN 731

  Fly   276 VILISLNDLRPL 287
            .:.:|.:|||.|
  Fly   732 YMRLSNHDLRVL 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15482NP_609614.2 DUF4729 105..300 CDD:292491 51/206 (25%)
CG11227NP_728371.1 DUF4729 551..754 CDD:292491 51/206 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.