DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15482 and boil

DIOPT Version :9

Sequence 1:NP_609614.2 Gene:CG15482 / 34717 FlyBaseID:FBgn0032483 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_572191.2 Gene:boil / 31416 FlyBaseID:FBgn0029730 Length:450 Species:Drosophila melanogaster


Alignment Length:256 Identity:56/256 - (21%)
Similarity:101/256 - (39%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SSSRKSTAT----TSSDSPWSRLRLV--------ACPCHGCLCSVDPSALLGHYLSDHLPGMGVP 136
            |.|||..||    ...|:...|..::        .|....|...|.||.:|.|.|..|.......
  Fly    10 SHSRKIEATPMDVEEKDNNRDRKHILNHLSRAPGKCILSNCNQLVFPSNMLVHMLRKHNNSPNTN 74

  Fly   137 FYELEMGKRVSLTCHISSLERDVNTLLGVYGYRRTGLNP-------LKCHRNTHLPVEYRRFSQH 194
            ...:...:|:..|.:::||:.|...:|.:..|..|...|       ...:.|..||..:.|:..|
  Fly    75 LAIIYDNQRLRKTFNLNSLKYDEPQVLNILLYAGTEGKPHTRPARRYLSYPNCGLPHSFGRYEHH 139

  Fly   195 SALMIFACRT-MHSVLWER----KRVK------HEVLAIWVATPLHGVAITLRLLVQPANLPRYY 248
            ..:.:..|:| ..|:|.:|    |..|      :.:..||    |.|...:.|:........|||
  Fly   140 LMMNLMICKTSWFSMLPDRICGEKLEKMHGTPENTIYVIW----LMGPETSSRMFYTLTAYDRYY 200

  Fly   249 TRQIKARPMLPLSSN----QSCSEFIKTDSNVILISLNDLRPLM--DLDVWQQSLTVELKV 303
               |::|.::..:.|    |...:|:..:::.:::...:...||  :.|...|:..::|::
  Fly   201 ---IQSRSVIRKTRNFFLSQQPKDFLNHENDYLMLRHEEAMDLMNGEGDELNQTSYIKLEL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15482NP_609614.2 DUF4729 105..300 CDD:292491 47/226 (21%)
boilNP_572191.2 DUF4729 43..249 CDD:292491 46/212 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469471
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.