DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15482 and CG12682

DIOPT Version :9

Sequence 1:NP_609614.2 Gene:CG15482 / 34717 FlyBaseID:FBgn0032483 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_572190.1 Gene:CG12682 / 31415 FlyBaseID:FBgn0029729 Length:237 Species:Drosophila melanogaster


Alignment Length:209 Identity:46/209 - (22%)
Similarity:77/209 - (36%) Gaps:22/209 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 TSSDSPWSRLRLVACPCHGCLCSVDPSALLGHYLSDHLP--GMGVPFY----ELEMGKRVSLTCH 151
            :|.|......:...||...|...|:.:.||.|.::.||.  ...:||.    |:..|:|..|...
  Fly     6 SSIDESIGHSKPAICPLADCQAVVEHTHLLRHMITKHLDPRARTLPFQLRLREVSTGQRTLLMLP 70

  Fly   152 ISSLERDVNTLLGVYGYRRTGLNPLKCHRNTHLPVEYRRFSQHSALMIFACRTMHSVL------- 209
            ...|..|.:..|.|..:.......|...: ..||..::..:.|..:::..|||....|       
  Fly    71 YRQLIIDNDQCLAVLNWSSVSQGDLTAPQ-LDLPPCHQMLTYHLPILVMVCRTTWKSLLKQIDEK 134

  Fly   210 --WERKRVKHE---VLAIWVATPLHGVAITLRLLVQPANLPRYYTRQIKARPMLPLSSNQSCSEF 269
              .|.:.|..|   |...|:.:||....|...|.:..:.:...|.|  ..|.:...:|.....:|
  Fly   135 DMQETRDVTAEWGGVYLFWLLSPLTRRPIYANLALLNSQIQSVYRR--NRRRIRNFASRMPIRQF 197

  Fly   270 IKTDSNVILISLND 283
            | ...:...:|:|:
  Fly   198 I-NGLDPYFVSINE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15482NP_609614.2 DUF4729 105..300 CDD:292491 44/197 (22%)
CG12682NP_572190.1 DUF4729 20..222 CDD:292491 44/195 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.