DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15482 and CG15472

DIOPT Version :9

Sequence 1:NP_609614.2 Gene:CG15482 / 34717 FlyBaseID:FBgn0032483 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_572184.1 Gene:CG15472 / 31409 FlyBaseID:FBgn0029724 Length:301 Species:Drosophila melanogaster


Alignment Length:260 Identity:58/260 - (22%)
Similarity:87/260 - (33%) Gaps:71/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VAAPAPEDQLLLKLQNFESLTEQPSSSRKSTATTSSDSPWSRLRLVACPCHGCLCSVDPSALLGH 124
            :::..||.|..|.|.:...|..|                        ||...|:.:|....:|.|
  Fly    12 LSSTEPEKQTKLTLNHLCQLPAQ------------------------CPIEKCISTVFKDDMLQH 52

  Fly   125 YLSDHLPG-----MGVPFYELEMGKRVSLTCHISSLERDVNTLLGV--YGYRRTGLNPLKCHRNT 182
            ....|...     :.|.|    .|:|.:|...:|.|.......|||  ||..|        .:::
  Fly    53 LAQRHFRSNVKKHLQVAF----NGERCTLVFDVSQLIGTQTICLGVLLYGGVR--------GKHS 105

  Fly   183 HLPVEYRRFSQHSALM-IFACRTMHSVLWERKRVKHEVLAIWVATPLHGVAITLRLLVQPANLPR 246
            .||.| |.|..|:.|. .....::...|.....||......|        |:..|.:....:|..
  Fly   106 QLPGE-REFCYHNRLKEDSGLESLKDYLPIMVLVKRTTFLCW--------ALVDRKMESQEDLNG 161

  Fly   247 YYTRQIKARPMLPLS--SNQSCSE--FIKTDSNVILISLNDLR--------PLMDLD---VWQQS 296
            ..::.:|....|..|  ::..|||  ..:.||..   ..|||:        .:||.|   :|.||
  Fly   162 KQSKDLKQVKHLDFSNDTHPKCSEESIKRCDSGQ---KNNDLKTTTEAEQEEIMDSDILIIWTQS 223

  Fly   297  296
              Fly   224  223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15482NP_609614.2 DUF4729 105..300 CDD:292491 51/215 (24%)
CG15472NP_572184.1 DUF4729 33..284 CDD:292491 52/239 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.