DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pect and PCYT1B

DIOPT Version :9

Sequence 1:NP_723789.2 Gene:Pect / 34716 FlyBaseID:FBgn0032482 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_004836.2 Gene:PCYT1B / 9468 HGNCID:8755 Length:369 Species:Homo sapiens


Alignment Length:182 Identity:57/182 - (31%)
Similarity:99/182 - (54%) Gaps:20/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KDVRVWCDGCYDMVHFGHANSLRQAKAL--GDKVIVGIHTDEEITKHKGPPVFTEEERVKMVKGI 81
            :.|||:.||.:|:.|.|||.:|.|||.|  ...::||:.:|:...|.||..|..|.||.:.::..
Human    75 RPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHC 139

  Fly    82 KWVDEVVLGAPYVTTLDVLDQNNCDFCVHGDDITMTAEGV-DTYHLVKSANRYKEVKRTAGVSTT 145
            ::||||:..||:..|.:.|:::..||..| |||..::.|. |.|..:|.|..:...:||.|:||:
Human   140 RYVDEVIRDAPWTLTPEFLEKHKIDFVAH-DDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTS 203

  Fly   146 DLVGRML----LLTRNHFRQG------------SAEYDIEKEVSILKRQIKS 181
            |::.|::    :..|.:.::|            ...|..:.:|..:|.::|:
Human   204 DIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PectNP_723789.2 PTZ00308 16..381 CDD:140329 57/182 (31%)
CCT 19..165 CDD:173925 53/164 (32%)
ECT 223..373 CDD:173924
PCYT1BNP_004836.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
PLN02413 72..314 CDD:215229 57/182 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.