DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pect and PCT1

DIOPT Version :9

Sequence 1:NP_723789.2 Gene:Pect / 34716 FlyBaseID:FBgn0032482 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_011718.1 Gene:PCT1 / 853116 SGDID:S000003434 Length:424 Species:Saccharomyces cerevisiae


Alignment Length:174 Identity:56/174 - (32%)
Similarity:95/174 - (54%) Gaps:13/174 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KDVRVWCDGCYDMVHFGHANSLRQAKALGDKV--IVGIHTDEEITKHKGPPVFTEEERVKMVKGI 81
            :.:|::.||.:|:.|.||...|.|.|.....|  |||:.:|:...|.||..|.|:::|.:.:...
Yeast   102 RPIRIYADGVFDLFHLGHMKQLEQCKKAFPNVTLIVGVPSDKITHKLKGLTVLTDKQRCETLTHC 166

  Fly    82 KWVDEVVLGAPYVTTLDVLDQNNCDFCVHGDDITMTAEGVDTYHLVKSANRYKEVKRTAGVSTTD 146
            :||||||..||:..|.:.|.::..|:..|.|...::|:..|.|..:|...::...:||.||||:|
Yeast   167 RWVDEVVPNAPWCVTPEFLLEHKIDYVAHDDIPYVSADSDDIYKPIKEMGKFLTTQRTNGVSTSD 231

  Fly   147 LVGRML-----LLTRNHFRQGSAEYDIEKEVSILKR---QIKSH 182
            ::.:::     .|.|| |.:|:...::  .||.||:   :.|.|
Yeast   232 IITKIIRDYDKYLMRN-FARGATRQEL--NVSWLKKNELEFKKH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PectNP_723789.2 PTZ00308 16..381 CDD:140329 56/174 (32%)
CCT 19..165 CDD:173925 50/152 (33%)
ECT 223..373 CDD:173924
PCT1NP_011718.1 CCT 102..251 CDD:173925 49/149 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.