DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pect and pcyt1ab

DIOPT Version :9

Sequence 1:NP_723789.2 Gene:Pect / 34716 FlyBaseID:FBgn0032482 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001018571.1 Gene:pcyt1ab / 553770 ZFINID:ZDB-GENE-050522-114 Length:359 Species:Danio rerio


Alignment Length:184 Identity:59/184 - (32%)
Similarity:100/184 - (54%) Gaps:20/184 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QRKDVRVWCDGCYDMVHFGHANSLRQAKAL--GDKVIVGIHTDEEITKHKGPPVFTEEERVKMVK 79
            :.:.|||:.||.:||.|.|||.:|.|||.|  ...:|||:.:|:...|.||..|..|:||...|.
Zfish    70 EERPVRVYADGIFDMFHSGHARALMQAKCLFPNTYLIVGVCSDDLTHKFKGFTVMNEDERYDAVC 134

  Fly    80 GIKWVDEVVLGAPYVTTLDVLDQNNCDFCVHGDDITMTAEGV-DTYHLVKSANRYKEVKRTAGVS 143
            ..::|||||..||:..:.:.|.::..||..| |||...:.|. |.|..:|.|..:...:||.|:|
Zfish   135 HCRYVDEVVRNAPWTLSPEFLAEHRIDFVAH-DDIPYISAGTDDVYRHIKDAGMFAPTQRTEGIS 198

  Fly   144 TTDLVGRML----LLTRNHFRQG------------SAEYDIEKEVSILKRQIKS 181
            |:|::.|::    :..|.:.::|            ..:|.:::.|..:|:::::
Zfish   199 TSDIITRIVRDYDVYVRRNLQRGYTAKELNVSFINEKKYHLQEHVDKVKQKVRN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PectNP_723789.2 PTZ00308 16..381 CDD:140329 59/184 (32%)
CCT 19..165 CDD:173925 56/164 (34%)
ECT 223..373 CDD:173924
pcyt1abNP_001018571.1 CCT 72..221 CDD:173925 55/149 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.