DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pect and PCYT1A

DIOPT Version :10

Sequence 1:NP_723789.2 Gene:Pect / 34716 FlyBaseID:FBgn0032482 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_005008.2 Gene:PCYT1A / 5130 HGNCID:8754 Length:367 Species:Homo sapiens


Alignment Length:181 Identity:60/181 - (33%)
Similarity:98/181 - (54%) Gaps:20/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KDVRVWCDGCYDMVHFGHANSLRQAKAL--GDKVIVGIHTDEEITKHKGPPVFTEEERVKMVKGI 81
            :.|||:.||.:|:.|.|||.:|.|||.|  ...:|||:.:||.....||..|..|.||...|:..
Human    75 RPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHC 139

  Fly    82 KWVDEVVLGAPYVTTLDVLDQNNCDFCVHGDDITMTAEGV-DTYHLVKSANRYKEVKRTAGVSTT 145
            ::|||||..||:..|.:.|.::..||..| |||..::.|. |.|..:|.|..:...:||.|:||:
Human   140 RYVDEVVRNAPWTLTPEFLAEHRIDFVAH-DDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTS 203

  Fly   146 DLVGRML----LLTRNHFRQG------------SAEYDIEKEVSILKRQIK 180
            |::.|::    :..|.:.::|            ..:|.:::.|..:|:::|
Human   204 DIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKYHLQERVDKVKKKVK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PectNP_723789.2 PTZ00308 16..381 CDD:140329 60/181 (33%)
PCYT1ANP_005008.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
CCT 75..224 CDD:173925 55/149 (37%)
Amphipathic. /evidence=ECO:0000255 228..287 4/27 (15%)
Autoinhibitory (AI). /evidence=ECO:0000250|UniProtKB:P19836 272..293
Amphipathic. /evidence=ECO:0000255 298..315
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..367
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.