DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pect and Pcyt2

DIOPT Version :9

Sequence 1:NP_723789.2 Gene:Pect / 34716 FlyBaseID:FBgn0032482 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_647622.1 Gene:Pcyt2 / 38180 FlyBaseID:FBgn0035231 Length:381 Species:Drosophila melanogaster


Alignment Length:171 Identity:64/171 - (37%)
Similarity:92/171 - (53%) Gaps:12/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KQRKDVRVWCDGCYDMVHFGHANSLRQAKALGDKV--IVGIHTDEEITKHKGPPVFTEEERVKMV 78
            |..:.|||:.||.||:.|.|||..|.|||.:...|  |||:..||...:.||..|....||.:.|
  Fly    74 KTTRRVRVYADGIYDLFHQGHARQLMQAKNVFPNVYLIVGVCNDELTLRMKGRTVMNGFERYEAV 138

  Fly    79 KGIKWVDEVVLGAPYVTTLDVLDQNNCDFCVHGDDITMTAEGV-DTYHLVKSANRYKEVKRTAGV 142
            :..::|||:|..||:....:.::::..||..| |||...|.|| |.|..:|:...:...:||.||
  Fly   139 RHCRYVDEIVPNAPWTLNEEFIEEHKIDFVAH-DDIPYGAGGVNDIYAPLKAKGMFVATERTEGV 202

  Fly   143 STTDLVGRM-----LLLTRNHFRQGSAEYDIEKEVSILKRQ 178
            ||:|:|.|:     :.:.||..|..||:   |..||.|..:
  Fly   203 STSDIVARIVKDYDVYVRRNLARGYSAK---ELNVSFLSEK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PectNP_723789.2 PTZ00308 16..381 CDD:140329 64/171 (37%)
CCT 19..165 CDD:173925 58/153 (38%)
ECT 223..373 CDD:173924
Pcyt2NP_647622.1 PLN02413 75..334 CDD:215229 63/170 (37%)
CCT 77..226 CDD:173925 56/149 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447744
Domainoid 1 1.000 54 1.000 Domainoid score I645
eggNOG 1 0.900 - - E1_COG0615
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.