DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pect and Pcyt1a

DIOPT Version :9

Sequence 1:NP_723789.2 Gene:Pect / 34716 FlyBaseID:FBgn0032482 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_511177.2 Gene:Pcyt1a / 140544 RGDID:70515 Length:367 Species:Rattus norvegicus


Alignment Length:191 Identity:63/191 - (32%)
Similarity:101/191 - (52%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ACNGYSDKQRKDVRVWCDGCYDMVHFGHANSLRQAKAL--GDKVIVGIHTDEEITKHKGPPVFTE 71
            ||.|  ....:.|||:.||.:|:.|.|||.:|.|||.|  ...:|||:.:||.....||..|..|
  Rat    67 ACRG--TPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNE 129

  Fly    72 EERVKMVKGIKWVDEVVLGAPYVTTLDVLDQNNCDFCVHGDDITMTAEGV-DTYHLVKSANRYKE 135
            .||...|:..::|||||..||:..|.:.|.::..||..| |||..::.|. |.|..:|.|..:..
  Rat   130 NERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAH-DDIPYSSAGSDDVYKHIKEAGMFAP 193

  Fly   136 VKRTAGVSTTDLVGRML----LLTRNHFRQG------------SAEYDIEKEVSILKRQIK 180
            .:||.|:||:|::.|::    :..|.:.::|            ..:|.:::.|..:|:::|
  Rat   194 TQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKYHLQERVDKVKKKVK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PectNP_723789.2 PTZ00308 16..381 CDD:140329 60/184 (33%)
CCT 19..165 CDD:173925 56/164 (34%)
ECT 223..373 CDD:173924
Pcyt1aNP_511177.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
CCT 75..224 CDD:173925 55/149 (37%)
Amphipathic. /evidence=ECO:0000255 228..287 4/27 (15%)
3 X 11 AA approximate tandem repeats 256..288
Amphipathic. /evidence=ECO:0000255 298..315
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..367
3 X repeats 319..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.