DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edem2 and alpha-Man-Ic

DIOPT Version :9

Sequence 1:NP_609611.1 Gene:Edem2 / 34714 FlyBaseID:FBgn0032480 Length:801 Species:Drosophila melanogaster
Sequence 2:NP_733331.1 Gene:alpha-Man-Ic / 318624 FlyBaseID:FBgn0051202 Length:526 Species:Drosophila melanogaster


Alignment Length:533 Identity:135/533 - (25%)
Similarity:225/533 - (42%) Gaps:107/533 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IFLVAMCIV--VACVL----STETTMPTQNMSNKER--AELREEARDMFYHAYNAYMQNAYPADE 74
            ||.|.:.::  :.|..    |.:..:|:.:.|.|:.  .::|.:.::|..||:..|.:..:..:|
  Fly    31 IFTVGVIVITYIQCRAMMRESFQKNIPSNDNSLKDMNPDDMRAKIKEMMMHAWRNYARVVWGTNE 95

  Fly    75 LMPLSCKGRYRGVTPSRGDMDDILGNFSMTLVDTLDTLVLLGDFTEFDHAVKLVIRDVQFDS-DI 138
            ..|:|.:..:.|        |........|::::||||.|:|...|...:...:.:....|. |.
  Fly    96 FRPISRRVHFGG--------DFATYKLGATIIESLDTLHLMGLNKELRRSRDWIEKSFHLDRVDE 152

  Fly   139 IVSVFETNIRMVGGLLSAHILAEYLQKHADTMHWYKGELLEMSR--ELGYRLLPAFNTSTGIPHA 201
            .:||:|...|::..:|              |::...|:.|.|.:  .:..::||||:|.||||..
  Fly   153 ALSVYELTSRLLCPML--------------TLYSLTGDSLYMDKAIHIADKILPAFDTPTGIPRR 203

  Fly   202 RVNLRLGMKDPMLKK--SRETCTACAGTILLEFAALSRLTGDPIFEVRAHAAMDALWKLRHRGSD 264
            .|..:.|   ..|.|  |..:.|:..|::.|||..||.::|.|::..|..|..:.|.|.. |.:.
  Fly   204 LVVPKEG---STLTKYLSDISRTSEFGSLHLEFYYLSEVSGYPVYRERVDAIREILAKTT-RPNG 264

  Fly   265 LMGTVLNVHSGDWVRRDSGVGAGIDSYYEYLFKSYVLLG--DDKYLARFNRHYNAV--------- 318
            |.........|.|    ......:...|:.|.||::..|  |.:....|.....||         
  Fly   265 LYPNAYCTKFGKW----ENYNCSMHRLYDTLLKSWIQSGRTDTQNADTFKEAMLAVAQNLVVINP 325

  Fly   319 --MKYVS---EGPMLLDVLMHRPHAKSKNFMDSLLAFWPGLQVLSGDLKPAVQTHEMLYQVMQMH 378
              :.|||   .|     .|.||        |.....|..||.||.     |.:| :|.:.....|
  Fly   326 EDVTYVSTFRNG-----TLFHR--------MRHSDCFAGGLFVLG-----AAET-QMKHWEKYAH 371

  Fly   379 TFI------------------PE--AFTVDFQ-----IHWGQHPLRPEFIESTYFLYRATGDHHY 418
            ..|                  |:  |||.:.|     :....:.||||..|:...|:|.|....|
  Fly   372 IGIGLTDTCHDSYWSSPTRLGPDTFAFTEESQQEIEPLQRNYYNLRPEVAETYLVLWRITHHPQY 436

  Fly   419 LQVGKKALKTLQQHAKVSCGYAAVNDVR--TGKHEDRMDSFVLSETIKYLFLLFSDPQDLIINVD 481
            ...|.:.::.::::.::..||..|.||.  |.:.:|...||.|..|:|||:|||||  |.:::::
  Fly   437 RLWGLEMVQAIEKYCRMPYGYTGVMDVNNVTSEPDDVQGSFFLGSTLKYLYLLFSD--DDVVSLE 499

  Fly   482 EFVFTTEAHLLPL 494
            ::||.:..|.||:
  Fly   500 QWVFNSAGHFLPI 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edem2NP_609611.1 Glyco_hydro_47 57..494 CDD:279825 125/484 (26%)
PA_EDEM3_like 645..770 CDD:239041
alpha-Man-IcNP_733331.1 Glyco_hydro_47 78..512 CDD:279825 125/484 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.