DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16974 and LINGO1

DIOPT Version :9

Sequence 1:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_116197.4 Gene:LINGO1 / 84894 HGNCID:21205 Length:620 Species:Homo sapiens


Alignment Length:624 Identity:145/624 - (23%)
Similarity:225/624 - (36%) Gaps:134/624 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 DRSELTYLPQRFL----GELSELRMLNLSQNLLTELPRDIFVGALKLERLYLSGNRLSVLPFMLF 319
            ||:.|.: .:||:    |..:|.|:|:|.:|.:..|.:|.|.....||.|.|:.|.:|.:....|
Human    52 DRAVLCH-RKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAF 115

  Fly   320 QTAADLQVLDLSDNRLLSFPDNFFARNGQLRQLHLQRNQLKSIGKHSLYSLRELRQLDLSQNSLS 384
            ....:|:.|.|..|||...|...|.....|.:|.:..|::..:..:....|..|:.|::..|.|.
Human   116 NNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLV 180

  Fly   385 VIDRKAFESLDHLLALNVSGNNLTLLSSIIFQSLHALRQLDLSRNQFKQLPSGLFQRQRSLVLLR 449
            .|..:||..|:.|..|.:...|||.:.:.....||.|..|.|.......:....|:|...|.:|.
Human   181 YISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLE 245

  Fly   450 IDETPIEQFSNWISRYDESLVDPQVLH----RLRYLSVQQNRKLTYLPATLFANTP-------NI 503
            |...|..........|..:|....:.|    .:.||:|   |.|.||.....:..|       .:
Human   246 ISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAV---RHLVYLRFLNLSYNPISTIEGSML 307

  Fly   504 RELLLAENGLLQL---------PTQISGLSRLQRLSVRGNSLGSLPENI-KELRQLHYLNILGNE 558
            .|||..:.  :||         |....||:.|:.|:|.||.|.:|.|:: ..:..|..|.:..|.
Human   308 HELLRLQE--IQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGNLETLILDSNP 370

  Fly   559 YQCDCSMYWL--TAWLANTSTSLRHQMPQAQNHSNGSTNQTP--LDSYESIDHQIDALKCQYGYR 619
            ..|||.:.|:  ..|..|    ...|.|         |..||  :...|..|.. |.|...|   
Human   371 LACDCRLLWVFRRRWRLN----FNRQQP---------TCATPEFVQGKEFKDFP-DVLLPNY--- 418

  Fly   620 GDMLRVLSKLNCSVPTVVQFSEPKMHKLL----STAKLECQISGSPVPDIIWVTPRNKILRHHAD 680
                     ..|   ...:..:.|..::.    .|.:..|:..|.|.|.|:|::||    :|   
Human   419 ---------FTC---RRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPR----KH--- 464

  Fly   681 PDKRPIIIDSKEDAHQPPSAQELAALMDESYIQSLNWTRQNSLVGRRVVLVENGSLLVHNISRID 745
                  ::.:|.:.                                |:.:..:|:|.|......|
Human   465 ------LVSAKSNG--------------------------------RLTVFPDGTLEVRYAQVQD 491

  Fly   746 SGLYTCYAFNVMGKASAGLRLYI------------DPIVFYRVKIGSILFGTALATA---FLLLT 795
            :|.|.|.|.|..|..|....|::            ....|...:.|.....:..||.   |.:.|
Human   492 NGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKT 556

  Fly   796 LIVQGLRSCLSRWGICNRFYCCVN----RKKKSPRKHQI 830
            ||:......:|..|:.  .:|.|.    .:.|...||.|
Human   557 LIIATTMGFISFLGVV--LFCLVLLFLWSRGKGNTKHNI 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_RI <246..433 CDD:238064 51/177 (29%)
LRR_8 251..311 CDD:290566 19/55 (35%)
leucine-rich repeat 253..276 CDD:275380 6/20 (30%)
leucine-rich repeat 277..300 CDD:275380 7/22 (32%)
leucine-rich repeat 301..324 CDD:275380 7/22 (32%)
LRR_8 325..383 CDD:290566 15/57 (26%)
leucine-rich repeat 325..348 CDD:275380 8/22 (36%)
leucine-rich repeat 349..372 CDD:275380 4/22 (18%)
LRR_RI 351..>557 CDD:238064 56/226 (25%)
LRR_8 371..431 CDD:290566 18/59 (31%)
leucine-rich repeat 373..396 CDD:275380 8/22 (36%)
leucine-rich repeat 397..420 CDD:275380 6/22 (27%)
leucine-rich repeat 421..444 CDD:275380 5/22 (23%)
LRR_8 477..536 CDD:290566 21/74 (28%)
leucine-rich repeat 478..502 CDD:275380 8/30 (27%)
leucine-rich repeat 503..526 CDD:275380 8/31 (26%)
Ig <714..761 CDD:299845 11/46 (24%)
LINGO1NP_116197.4 LRRNT 41..75 CDD:214470 7/23 (30%)
LRR <66..371 CDD:227223 82/309 (27%)
LRR 1 72..93 8/20 (40%)
leucine-rich repeat 73..96 CDD:275380 7/22 (32%)
LRR 2 96..117 7/20 (35%)
leucine-rich repeat 97..120 CDD:275380 7/22 (32%)
LRR_8 120..179 CDD:338972 15/58 (26%)
LRR 3 120..141 8/20 (40%)
leucine-rich repeat 121..144 CDD:275380 8/22 (36%)
LRR 4 144..165 3/20 (15%)
leucine-rich repeat 145..192 CDD:275380 12/46 (26%)
LRR 5 168..189 7/20 (35%)
LRR 6 192..213 5/20 (25%)
leucine-rich repeat 193..216 CDD:275380 6/22 (27%)
LRR 7 216..237 4/20 (20%)
leucine-rich repeat 217..264 CDD:275380 10/46 (22%)
LRR 8 264..285 5/23 (22%)
leucine-rich repeat 265..288 CDD:275380 7/25 (28%)
LRR 9 288..309 3/20 (15%)
leucine-rich repeat 289..312 CDD:275380 4/22 (18%)
LRR 10 312..333 3/22 (14%)
leucine-rich repeat 313..336 CDD:275380 5/24 (21%)
LRR 11 336..357 8/20 (40%)
leucine-rich repeat 337..357 CDD:275380 8/19 (42%)
PCC 341..>421 CDD:188093 25/105 (24%)
Ig 439..514 CDD:386229 24/119 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D195414at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.