DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16974 and RLP38

DIOPT Version :9

Sequence 1:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_188953.1 Gene:RLP38 / 821887 AraportID:AT3G23120 Length:784 Species:Arabidopsis thaliana


Alignment Length:451 Identity:111/451 - (24%)
Similarity:171/451 - (37%) Gaps:124/451 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LECLHW------AIPLAVRRVKVLEMSGNRLSNCSLLNLQYMKQLQEL-HLDRSELTY---LPQR 269
            ::|..|      ||...|..:|:..:|   .::.||.:...:.:||.| |||.|....   :|..
plant    68 IDCCSWGGVTCDAILGEVISLKLYFLS---TASTSLKSSSALFKLQHLTHLDLSNCNLQGEIPSS 129

  Fly   270 FLGELSELRMLNLSQN-LLTELPRDIFVGAL-KLERLYLSGN--------------RLSVLPF-- 316
             :..||.|..|:||.| |:.|:|..|  |.| :||.:.|.||              :||:|..  
plant   130 -IENLSHLTHLDLSTNHLVGEVPASI--GNLNQLEYIDLRGNHLRGNIPTSFANLTKLSLLDLHE 191

  Fly   317 -------MLFQTAADLQVLDLSDNRLLSF----------------PDNFFA--------RNGQLR 350
                   ::......|.:||||.|...||                .:|.|.        :...|.
plant   192 NNFTGGDIVLSNLTSLAILDLSSNHFKSFFSADLSGLHNLEQIFGNENSFVGLFPASLLKISSLD 256

  Fly   351 QLHLQRNQLKS-----------------------IGK--HSLYSLRELRQLDLSQNSLSVIDRKA 390
            ::.|.:||.:.                       ||:  .||..|..|..||||.|:...:..::
plant   257 KIQLSQNQFEGPIDFGNTSSSSRLTMLDISHNNFIGRVPSSLSKLVNLELLDLSHNNFRGLSPRS 321

  Fly   391 FESLDHLLALNVSGNNLTLLSSIIFQSLHALRQLDLSRNQFKQLPS-----------GLFQRQRS 444
            ...|.:|.:|::|.|.|.............|:.:|||.|.|..|..           ||.....|
plant   322 ISKLVNLTSLDISYNKLEGQVPYFIWKPSNLQSVDLSHNSFFDLGKSVEVVNGAKLVGLNLGSNS 386

  Fly   445 LVLLRIDETPIEQFSNWISRYDESLVDPQVLHRLRYLSVQQNRKLTYLPATLFANTPNIRELLLA 509
            |      :.||.|   ||..:          ..:.:|.:..||....:|..| .|:.:...|.|.
plant   387 L------QGPIPQ---WICNF----------RFVFFLDLSDNRFTGSIPQCL-KNSTDFNTLNLR 431

  Fly   510 ENGLLQ-LPTQISGLSRLQRLSVR-GNSLGSLPENIKELRQLHYLNILGNEYQCDCSMYWL 568
            .|.|.. ||......:.|:.|.|. .|.:|.||:::...:.:.:||:.||:.: |...:||
plant   432 NNSLSGFLPELCMDSTMLRSLDVSYNNFVGKLPKSLMNCQDMEFLNVRGNKIK-DTFPFWL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380 5/18 (28%)
leucine-rich repeat 229..252 CDD:275380 4/22 (18%)
LRR_RI <246..433 CDD:238064 66/264 (25%)
LRR_8 251..311 CDD:290566 26/79 (33%)
leucine-rich repeat 253..276 CDD:275380 9/26 (35%)
leucine-rich repeat 277..300 CDD:275380 11/24 (46%)
leucine-rich repeat 301..324 CDD:275380 8/45 (18%)
LRR_8 325..383 CDD:290566 25/106 (24%)
leucine-rich repeat 325..348 CDD:275380 10/46 (22%)
leucine-rich repeat 349..372 CDD:275380 9/47 (19%)
LRR_RI 351..>557 CDD:238064 57/243 (23%)
LRR_8 371..431 CDD:290566 17/59 (29%)
leucine-rich repeat 373..396 CDD:275380 7/22 (32%)
leucine-rich repeat 397..420 CDD:275380 5/22 (23%)
leucine-rich repeat 421..444 CDD:275380 9/33 (27%)
LRR_8 477..536 CDD:290566 16/60 (27%)
leucine-rich repeat 478..502 CDD:275380 6/23 (26%)
leucine-rich repeat 503..526 CDD:275380 6/23 (26%)
Ig <714..761 CDD:299845
RLP38NP_188953.1 PLN00113 11..>721 CDD:331614 111/451 (25%)
leucine-rich repeat 112..135 CDD:275380 7/23 (30%)
leucine-rich repeat 136..159 CDD:275380 11/24 (46%)
leucine-rich repeat 160..183 CDD:275380 5/22 (23%)
leucine-rich repeat 184..206 CDD:275380 3/21 (14%)
leucine-rich repeat 207..254 CDD:275380 10/46 (22%)
leucine-rich repeat 255..276 CDD:275380 4/20 (20%)
leucine-rich repeat 280..303 CDD:275380 5/22 (23%)
leucine-rich repeat 304..327 CDD:275380 7/22 (32%)
leucine-rich repeat 352..376 CDD:275380 7/23 (30%)
leucine-rich repeat 377..397 CDD:275380 9/28 (32%)
leucine-rich repeat 401..424 CDD:275380 6/23 (26%)
leucine-rich repeat 425..448 CDD:275380 6/22 (27%)
leucine-rich repeat 449..472 CDD:275380 7/22 (32%)
leucine-rich repeat 473..496 CDD:275380 7/20 (35%)
leucine-rich repeat 523..545 CDD:275380
leucine-rich repeat 659..682 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.