DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16974 and LINGO3

DIOPT Version :10

Sequence 1:NP_609610.2 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_001094861.1 Gene:LINGO3 / 645191 HGNCID:21206 Length:592 Species:Homo sapiens


Alignment Length:622 Identity:148/622 - (23%)
Similarity:232/622 - (37%) Gaps:135/622 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RLECLHWAIPLAVRRVKVLEMSGNRLSNCSLLNLQYMKQLQELHLDRSELTYLPQRFLGELSELR 278
            ||..:...||...|   :||:|.||:...:..:|..:..|:||.|..:.:.::.......|..||
Human    44 RLTAVPDGIPAETR---LLELSRNRIRCLNPGDLAALPALEELDLSENAIAHVEPGAFANLPRLR 105

  Fly   279 MLNLSQNLLTELPRDIFVGALKLERLYLSGNRLSVLPFMLFQTAADLQVLDLSDNRLLSFPDNFF 343
            :|.|..|.|..:|..:|.....|..|.||.|:|.:|....||....|:.|::.||.|:......|
Human   106 VLRLRGNQLKLIPPGVFTRLDNLTLLDLSENKLVILLDYTFQDLHSLRRLEVGDNDLVFVSRRAF 170

  Fly   344 ARNGQLRQLHLQRNQLKSIGKHSLYSLRELRQLDLSQNSLSVIDRKAFESLDHLLALNVSGNNLT 408
            |....|.:|.|:|..|.::...||..||.|..|.|...:::.::.:.|..|..||.|.:  :|..
Human   171 AGLLALEELTLERCNLTALSGESLGHLRSLGALRLRHLAIASLEDQNFRRLPGLLHLEI--DNWP 233

  Fly   409 LLSSIIFQSLHALR--QLDLSRNQFKQLPSGLFQRQRSLVLLRIDETPIEQFSNWISRYDESLVD 471
            ||..:...||..|.  .|.::......:|:...:.|..|..|.:...||                
Human   234 LLEEVAAGSLRGLNLTSLSVTHTNITAVPAAALRHQAHLTCLNLSHNPI---------------- 282

  Fly   472 PQVLHRLRYLSVQQNRKLTYLPATLFANTPNIRELLLAENGLLQL--PTQISGLSRLQRLSVRGN 534
                              :.:|...|.:...:|||.|| ..||.:  |....||.:::.|::..|
Human   283 ------------------STVPRGSFRDLVRLRELHLA-GALLAVVEPQAFLGLRQIRLLNLSNN 328

  Fly   535 SLGSLPEN-IKELRQLHYLNILGNEYQCDCSMYWLTAWLANTSTSLRHQMPQAQNHSNGSTNQTP 598
            .|.:|.|: ...:..|..|.:.||...|||.:.|:.               |.:...|       
Human   329 LLSTLEESTFHSVNTLETLRVDGNPLACDCRLLWIV---------------QRRKTLN------- 371

  Fly   599 LDSYESIDHQIDALKCQYGYRGDMLR------VLSKLNCSVPTVVQFSEPKMHKLLSTA----KL 653
                  .|.::.|.......|||.||      :.....|..|.:   .|.::.::.:||    :.
Human   372 ------FDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKI---RERRLQRVTATAGEDVRF 427

  Fly   654 ECQISGSPVPDIIWVTPRNKILRHHADPDKRPIIIDSKEDAHQPPSAQELAALMDESYIQSLNWT 718
            .|:..|.|.|.:.||||:                       |:|.:|                  
Human   428 LCRAEGEPAPTVAWVTPQ-----------------------HRPVTA------------------ 451

  Fly   719 RQNSLVGRRVVLVENGSLLVHNISRIDSGLYTCYAFNVMGKASAGLRLYIDPIVFYRVKIGSILF 783
               :..||..|| ..|:|.:.:....|||.|||.|.|..|..:....|.:.|........|....
Human   452 ---TSAGRARVL-PGGTLEIQDARPQDSGTYTCVASNAGGNDTYFATLTVRPEPAANRTPGEAHN 512

  Fly   784 GT--ALATAFLLLTLIVQGLRSCLSRWGICNRFYCCV 818
            .|  ||.....|.|::|.....|::..|:.  .:|.|
Human   513 ETLAALRAPLDLTTILVSTAMGCITFLGVV--LFCFV 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16974NP_609610.2 leucine-rich repeat 206..228 CDD:275380 4/13 (31%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR <230..531 CDD:443914 78/304 (26%)
leucine-rich repeat 253..276 CDD:275380 5/22 (23%)
leucine-rich repeat 277..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..324 CDD:275380 9/22 (41%)
leucine-rich repeat 325..348 CDD:275380 7/22 (32%)
leucine-rich repeat 349..372 CDD:275380 8/22 (36%)
leucine-rich repeat 373..396 CDD:275380 5/22 (23%)
leucine-rich repeat 397..420 CDD:275380 8/22 (36%)
leucine-rich repeat 421..444 CDD:275380 4/24 (17%)
leucine-rich repeat 478..502 CDD:275380 2/23 (9%)
leucine-rich repeat 503..526 CDD:275380 10/24 (42%)
Ig <714..761 CDD:472250 15/46 (33%)
Ig strand C 714..718 CDD:409358 0/3 (0%)
Ig strand E 734..738 CDD:409358 2/3 (67%)
Ig strand F 748..753 CDD:409358 3/4 (75%)
LINGO3NP_001094861.1 LRRNT 24..58 CDD:214470 5/16 (31%)
LRR 54..>303 CDD:443914 73/288 (25%)
LRR 1 55..76 7/23 (30%)
leucine-rich repeat 59..79 CDD:275380 6/19 (32%)
LRR 2 79..100 4/20 (20%)
leucine-rich repeat 80..103 CDD:275380 5/22 (23%)
LRR 3 103..124 8/20 (40%)
leucine-rich repeat 104..127 CDD:275380 8/22 (36%)
LRR 4 127..148 8/20 (40%)
leucine-rich repeat 128..151 CDD:275380 9/22 (41%)
LRR 5 151..172 6/20 (30%)
leucine-rich repeat 152..199 CDD:275380 15/46 (33%)
LRR 6 175..196 7/20 (35%)
leucine-rich repeat 200..223 CDD:275380 5/22 (23%)
LRR 7 207..228 4/20 (20%)
leucine-rich repeat 224..247 CDD:275380 8/24 (33%)
LRR 8 247..268 2/20 (10%)
leucine-rich repeat 248..271 CDD:275380 3/22 (14%)
LRR 9 271..292 6/54 (11%)
leucine-rich repeat 272..293 CDD:275380 6/54 (11%)
LRR 10 295..316 8/21 (38%)
leucine-rich repeat 296..319 CDD:275380 10/23 (43%)
LRR 11 319..340 5/20 (25%)
leucine-rich repeat 322..343 CDD:275380 5/20 (25%)
PCC 334..>406 CDD:188093 19/99 (19%)
Ig 408..497 CDD:472250 30/136 (22%)
Ig strand B 425..429 CDD:409353 0/3 (0%)
Ig strand C 438..442 CDD:409353 0/3 (0%)
Ig strand E 463..467 CDD:409353 2/3 (67%)
Ig strand F 477..482 CDD:409353 3/4 (75%)
Ig strand G 490..493 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.