| Sequence 1: | NP_001246018.1 | Gene: | CG16974 / 34713 | FlyBaseID: | FBgn0032479 | Length: | 1257 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001920877.1 | Gene: | si:ch211-237i5.4 / 557635 | ZFINID: | ZDB-GENE-131121-468 | Length: | 346 | Species: | Danio rerio |
| Alignment Length: | 269 | Identity: | 78/269 - (28%) |
|---|---|---|---|
| Similarity: | 113/269 - (42%) | Gaps: | 63/269 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 327 VLDLSDNRLLSFPDNFFARNGQLRQLHLQRNQLKSIGKHSLYSLRELRQLDLSQNSLSVIDRKAF 391
Fly 392 ESLDHLLALNVSGNNLTLLSSIIFQSLHALRQLDLSRNQFKQLPSGLFQRQRSLVLLRIDETPIE 456
Fly 457 QFSNWISRYDESLVDPQVLHRLRYLSVQQN-------RKLTYLPATLFANTPNIRELLLAENGLL 514
Fly 515 QLPTQISGLSRLQRLS---VRGNSLGSLPENIKELRQLH----YLNILGNEYQCDCSMYWLTAWL 572
Fly 573 ANTSTSLRH 581 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG16974 | NP_001246018.1 | leucine-rich repeat | 206..228 | CDD:275380 | |
| leucine-rich repeat | 229..252 | CDD:275380 | |||
| LRR_RI | <246..433 | CDD:238064 | 37/105 (35%) | ||
| LRR_8 | 251..311 | CDD:290566 | |||
| leucine-rich repeat | 253..276 | CDD:275380 | |||
| leucine-rich repeat | 277..300 | CDD:275380 | |||
| leucine-rich repeat | 301..324 | CDD:275380 | |||
| LRR_8 | 325..383 | CDD:290566 | 19/55 (35%) | ||
| leucine-rich repeat | 325..348 | CDD:275380 | 8/20 (40%) | ||
| leucine-rich repeat | 349..372 | CDD:275380 | 6/22 (27%) | ||
| LRR_RI | 351..>557 | CDD:238064 | 59/219 (27%) | ||
| LRR_8 | 371..431 | CDD:290566 | 23/59 (39%) | ||
| leucine-rich repeat | 373..396 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 397..420 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 421..444 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 477..536 | CDD:290566 | 22/68 (32%) | ||
| leucine-rich repeat | 478..502 | CDD:275380 | 11/30 (37%) | ||
| leucine-rich repeat | 503..526 | CDD:275380 | 5/22 (23%) | ||
| Ig | <714..761 | CDD:299845 | |||
| si:ch211-237i5.4 | XP_001920877.1 | leucine-rich repeat | 34..53 | CDD:275380 | |
| leucine-rich repeat | 54..75 | CDD:275380 | 8/20 (40%) | ||
| LRR_RI | <69..238 | CDD:238064 | 61/213 (29%) | ||
| LRR_8 | 75..134 | CDD:290566 | 19/58 (33%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 122..182 | CDD:290566 | 23/92 (25%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 10/55 (18%) | ||
| LRR_8 | 170..230 | CDD:290566 | 22/69 (32%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 6/24 (25%) | ||
| leucine-rich repeat | 220..240 | CDD:275380 | 8/21 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24366 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||