DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16974 and CG32055

DIOPT Version :9

Sequence 1:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster


Alignment Length:654 Identity:145/654 - (22%)
Similarity:262/654 - (40%) Gaps:169/654 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAISKISLILCALFVG--LKAAAAISGDSTHC--LATYSSAEAYLAQIPQQHRPQIRPRIRTWQ 61
            |:|:..::|:|.:...|  |:....:...|..|  :.::.....|:.              :.|:
  Fly     1 MQALQVLALLLLSGVFGKDLQECEDLGNGSYLCREIESFEQLNRYVG--------------KNWK 51

  Fly    62 ------EHEFSLLGYKFHLPFVGHAVDSDLDDSD----SDEGLW-------LDAADAGSESVEVE 109
                  ||..........||.:...:..||.:|.    .::||.       |:...|..:.::.|
  Fly    52 SVKVVNEHTGIERAEDGELPGLSTLLQLDLSESGGVTLGEKGLQDFKALQKLNLTHAQLDELKSE 116

  Fly   110 EHELPSVGHVDPTGNVFKLNCEHVDLRRVNQELLSQRSS--HINYNQLMLAHVPADRSNPLKLPQ 172
            :...||        .:...:..:.|:..:..:|:|...:  :.|:::.::|.:     .|.....
  Fly   117 QFPNPS--------EMINFDVSYNDILAITTKLMSGFGNLVYANFSENLIAVI-----EPNAFRH 168

  Fly   173 LESLREFSWQSSELKDETLMELFTRQPRSFEYMERLNLAENRLECLHWAIPLAVRRVKVLEMSGN 237
            :::||             .::|.|      .|.|.:.|.||             ..::.|.:|.|
  Fly   169 MKNLR-------------FLDLTT------NYQENITLGEN-------------ANLRFLSISNN 201

  Fly   238 RLSNCSLLNLQYMKQLQELHLDRSELTYLPQRFLGELSELRMLNLSQNLLTELPRDIFVGALKLE 302
            .|.:....:|:.:.:|:||||..:.|.:|.......|..||:||:|.|.|.|:.|.:|:...:: 
  Fly   202 NLRDFQWCHLRVLPKLEELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEI- 265

  Fly   303 RLYLSGNRLSVLPFMLFQTAADLQVLDLSDNRLLSFPDNFFARNGQLRQLHLQRNQLKSIGKHSL 367
                                |.|::||.|.|.:....|:.|.|                      
  Fly   266 --------------------APLELLDYSSNIVKVLDDSVFCR---------------------- 288

  Fly   368 YSLRELRQLDLSQNSLSVIDRKAFESLDHLLALNVSGNNLTLLSSIIFQSLHALRQLDLSRNQFK 432
              |::||.|:|..|.::.|..:||..|..|..|::.||.:::|...:|.:|.||.:||||:|..:
  Fly   289 --LKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQ 351

  Fly   433 QLPSGLFQRQ--RSLVLLRIDETPIEQFSNWISRYDESLVDPQVLHRLRY---LSVQQNRKLTYL 492
            :|...:|..:  |.|:.|.:.       :|:|:.     :.|..|..:.:   |.:::|| |..|
  Fly   352 KLGLRVFGERILRKLIYLDLS-------NNYIAD-----LHPLALSSMPFIKELRLRRNR-LVSL 403

  Fly   493 PATLFANTPNIRELLLAENGLLQLPTQI-SGLSRLQRLSVRGNSLGSLPE--NIKELRQLHYLNI 554
            ...:||....::.|.:.||.|.::..:| ..|.||..|.:..|.|..||:  :.:.|.||..:.:
  Fly   404 DLRMFAPLRQLQLLTINENRLEEIDGEILDTLDRLNHLELNNNRLTFLPDLKSSQNLLQLRNITL 468

  Fly   555 LGNEYQCDCSMYWLTAWLANTSTSLRHQMPQAQNHSNGS--TNQTPLD----------------S 601
            .||.:||.| :..:|:||.....|  :..|.:...|...  ...||:|                |
  Fly   469 EGNPWQCLC-LDEITSWLNGRHVS--YARPSSAYFSGRKPLCVVTPMDKCLRDLQETKAQGIVES 530

  Fly   602 YESI 605
            ||.|
  Fly   531 YEKI 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380 4/21 (19%)
leucine-rich repeat 229..252 CDD:275380 5/22 (23%)
LRR_RI <246..433 CDD:238064 52/186 (28%)
LRR_8 251..311 CDD:290566 18/59 (31%)
leucine-rich repeat 253..276 CDD:275380 8/22 (36%)
leucine-rich repeat 277..300 CDD:275380 10/22 (45%)
leucine-rich repeat 301..324 CDD:275380 0/22 (0%)
LRR_8 325..383 CDD:290566 14/57 (25%)
leucine-rich repeat 325..348 CDD:275380 8/22 (36%)
leucine-rich repeat 349..372 CDD:275380 1/22 (5%)
LRR_RI 351..>557 CDD:238064 56/213 (26%)
LRR_8 371..431 CDD:290566 23/59 (39%)
leucine-rich repeat 373..396 CDD:275380 9/22 (41%)
leucine-rich repeat 397..420 CDD:275380 7/22 (32%)
leucine-rich repeat 421..444 CDD:275380 8/24 (33%)
LRR_8 477..536 CDD:290566 17/62 (27%)
leucine-rich repeat 478..502 CDD:275380 7/26 (27%)
leucine-rich repeat 503..526 CDD:275380 6/23 (26%)
Ig <714..761 CDD:299845
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 5/22 (23%)
leucine-rich repeat 100..123 CDD:275380 5/30 (17%)
LRR_8 128..180 CDD:290566 10/75 (13%)
leucine-rich repeat 128..147 CDD:275380 3/18 (17%)
leucine-rich repeat 148..171 CDD:275380 3/27 (11%)
leucine-rich repeat 172..192 CDD:275380 9/51 (18%)
LRR_RI <187..400 CDD:238064 71/283 (25%)
LRR_8 192..251 CDD:290566 19/58 (33%)
leucine-rich repeat 193..216 CDD:275380 5/22 (23%)
leucine-rich repeat 217..240 CDD:275380 8/22 (36%)
leucine-rich repeat 241..267 CDD:275380 10/46 (22%)
leucine-rich repeat 268..291 CDD:275380 9/46 (20%)
LRR_8 290..350 CDD:290566 23/59 (39%)
leucine-rich repeat 292..315 CDD:275380 9/22 (41%)
leucine-rich repeat 316..339 CDD:275380 7/22 (32%)
LRR_8 340..400 CDD:290566 18/72 (25%)
leucine-rich repeat 340..365 CDD:275380 8/24 (33%)
leucine-rich repeat 366..389 CDD:275380 6/34 (18%)
leucine-rich repeat 390..413 CDD:275380 7/23 (30%)
LRR_8 391..448 CDD:290566 17/57 (30%)
leucine-rich repeat 414..437 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.