DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16974 and CG32055

DIOPT Version :10

Sequence 1:NP_609610.2 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster


Alignment Length:654 Identity:145/654 - (22%)
Similarity:262/654 - (40%) Gaps:169/654 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAISKISLILCALFVG--LKAAAAISGDSTHC--LATYSSAEAYLAQIPQQHRPQIRPRIRTWQ 61
            |:|:..::|:|.:...|  |:....:...|..|  :.::.....|:.              :.|:
  Fly     1 MQALQVLALLLLSGVFGKDLQECEDLGNGSYLCREIESFEQLNRYVG--------------KNWK 51

  Fly    62 ------EHEFSLLGYKFHLPFVGHAVDSDLDDSD----SDEGLW-------LDAADAGSESVEVE 109
                  ||..........||.:...:..||.:|.    .::||.       |:...|..:.::.|
  Fly    52 SVKVVNEHTGIERAEDGELPGLSTLLQLDLSESGGVTLGEKGLQDFKALQKLNLTHAQLDELKSE 116

  Fly   110 EHELPSVGHVDPTGNVFKLNCEHVDLRRVNQELLSQRSS--HINYNQLMLAHVPADRSNPLKLPQ 172
            :...||        .:...:..:.|:..:..:|:|...:  :.|:::.::|.:     .|.....
  Fly   117 QFPNPS--------EMINFDVSYNDILAITTKLMSGFGNLVYANFSENLIAVI-----EPNAFRH 168

  Fly   173 LESLREFSWQSSELKDETLMELFTRQPRSFEYMERLNLAENRLECLHWAIPLAVRRVKVLEMSGN 237
            :::||             .::|.|      .|.|.:.|.||             ..::.|.:|.|
  Fly   169 MKNLR-------------FLDLTT------NYQENITLGEN-------------ANLRFLSISNN 201

  Fly   238 RLSNCSLLNLQYMKQLQELHLDRSELTYLPQRFLGELSELRMLNLSQNLLTELPRDIFVGALKLE 302
            .|.:....:|:.:.:|:||||..:.|.:|.......|..||:||:|.|.|.|:.|.:|:...:: 
  Fly   202 NLRDFQWCHLRVLPKLEELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEI- 265

  Fly   303 RLYLSGNRLSVLPFMLFQTAADLQVLDLSDNRLLSFPDNFFARNGQLRQLHLQRNQLKSIGKHSL 367
                                |.|::||.|.|.:....|:.|.|                      
  Fly   266 --------------------APLELLDYSSNIVKVLDDSVFCR---------------------- 288

  Fly   368 YSLRELRQLDLSQNSLSVIDRKAFESLDHLLALNVSGNNLTLLSSIIFQSLHALRQLDLSRNQFK 432
              |::||.|:|..|.::.|..:||..|..|..|::.||.:::|...:|.:|.||.:||||:|..:
  Fly   289 --LKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQ 351

  Fly   433 QLPSGLFQRQ--RSLVLLRIDETPIEQFSNWISRYDESLVDPQVLHRLRY---LSVQQNRKLTYL 492
            :|...:|..:  |.|:.|.:.       :|:|:.     :.|..|..:.:   |.:::|| |..|
  Fly   352 KLGLRVFGERILRKLIYLDLS-------NNYIAD-----LHPLALSSMPFIKELRLRRNR-LVSL 403

  Fly   493 PATLFANTPNIRELLLAENGLLQLPTQI-SGLSRLQRLSVRGNSLGSLPE--NIKELRQLHYLNI 554
            ...:||....::.|.:.||.|.::..:| ..|.||..|.:..|.|..||:  :.:.|.||..:.:
  Fly   404 DLRMFAPLRQLQLLTINENRLEEIDGEILDTLDRLNHLELNNNRLTFLPDLKSSQNLLQLRNITL 468

  Fly   555 LGNEYQCDCSMYWLTAWLANTSTSLRHQMPQAQNHSNGS--TNQTPLD----------------S 601
            .||.:||.| :..:|:||.....|  :..|.:...|...  ...||:|                |
  Fly   469 EGNPWQCLC-LDEITSWLNGRHVS--YARPSSAYFSGRKPLCVVTPMDKCLRDLQETKAQGIVES 530

  Fly   602 YESI 605
            ||.|
  Fly   531 YEKI 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16974NP_609610.2 leucine-rich repeat 206..228 CDD:275380 4/21 (19%)
leucine-rich repeat 229..252 CDD:275380 5/22 (23%)
LRR <230..531 CDD:443914 81/306 (26%)
leucine-rich repeat 253..276 CDD:275380 8/22 (36%)
leucine-rich repeat 277..300 CDD:275380 10/22 (45%)
leucine-rich repeat 301..324 CDD:275380 0/22 (0%)
leucine-rich repeat 325..348 CDD:275380 8/22 (36%)
leucine-rich repeat 349..372 CDD:275380 1/22 (5%)
leucine-rich repeat 373..396 CDD:275380 9/22 (41%)
leucine-rich repeat 397..420 CDD:275380 7/22 (32%)
leucine-rich repeat 421..444 CDD:275380 8/24 (33%)
leucine-rich repeat 478..502 CDD:275380 7/26 (27%)
leucine-rich repeat 503..526 CDD:275380 6/23 (26%)
Ig <714..761 CDD:472250
Ig strand C 714..718 CDD:409358
Ig strand E 734..738 CDD:409358
Ig strand F 748..753 CDD:409358
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 5/22 (23%)
leucine-rich repeat 100..123 CDD:275380 5/30 (17%)
LRR_8 126..180 CDD:404697 10/77 (13%)
leucine-rich repeat 128..147 CDD:275380 3/18 (17%)
leucine-rich repeat 148..171 CDD:275380 3/27 (11%)
LRR 171..>486 CDD:443914 104/405 (26%)
leucine-rich repeat 172..192 CDD:275380 9/51 (18%)
leucine-rich repeat 193..216 CDD:275380 5/22 (23%)
leucine-rich repeat 217..240 CDD:275380 8/22 (36%)
leucine-rich repeat 241..267 CDD:275380 10/46 (22%)
leucine-rich repeat 268..291 CDD:275380 9/46 (20%)
leucine-rich repeat 292..315 CDD:275380 9/22 (41%)
leucine-rich repeat 316..339 CDD:275380 7/22 (32%)
leucine-rich repeat 340..365 CDD:275380 8/24 (33%)
leucine-rich repeat 366..389 CDD:275380 6/34 (18%)
leucine-rich repeat 390..413 CDD:275380 7/23 (30%)
leucine-rich repeat 414..437 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.