DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16974 and Lapsyn

DIOPT Version :9

Sequence 1:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_611561.1 Gene:Lapsyn / 37418 FlyBaseID:FBgn0034602 Length:343 Species:Drosophila melanogaster


Alignment Length:324 Identity:80/324 - (24%)
Similarity:127/324 - (39%) Gaps:62/324 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LHWAIPLAVRRVKVLEMSGNRLSNCSLLNLQYMKQLQELH----LDRSELTYLPQRFLGELSELR 278
            |||.:                        |.::..||.||    :.:||:.......:.:|..:|
  Fly     3 LHWQL------------------------LTFIVCLQLLHSAGFIIQSEVRKCTYGHIDKLLRIR 43

  Fly   279 MLNLSQNLLTELPRDIFVGALKLERLYLSGNRLSVLPFMLFQTAADLQVLDLSDNRLLSFPDNFF 343
            ..:|.   |.|:|:::   ...:|.|.||.||:..|....||...|::.|.|.||.:||.....|
  Fly    44 CYDLD---LKEVPQNL---KSSVEVLDLSHNRIRKLKTSSFQRYTDIKFLMLYDNMILSVEVGTF 102

  Fly   344 ARNGQLRQLHLQRNQLKSIGKHSLYSLRELRQLDLSQNSLSVIDRKAFES-----LDHLLALNVS 403
            .....|:::.|..|.|.:| ...|:.|..||.|.:..|.|:.::.:|.|.     |::   |||:
  Fly   103 EPLTSLQEIDLSNNGLTTI-PLELFQLPRLRNLYIDSNELTSLNLQALEKPIRAPLEY---LNVA 163

  Fly   404 GNNLTLLSSIIFQSLHALRQLDLSRNQFKQLPSGLFQRQRSLVLLRIDETPIEQFSNWISRYDES 468
            |..|..|..:  ..|..|.||:.|.|..:............|.::.:.::.:.|..         
  Fly   164 GCELQELPDL--GILPKLWQLNASMNPLQNFRIDSLANMCHLQVIDLTKSQLSQCG--------- 217

  Fly   469 LVDPQVLHRLRYLSVQQNRKLTYLPATLFANTPNIRELLLAENGLLQLPTQISGLSRLQRLSVR 532
              ..||.:.|..|.....    ::|..|.|  .:|||..|..|..:..||..|..:.||....|
  Fly   218 --CQQVTNHLMMLGASPK----FVPVCLEA--LDIRECPLPYNRTIHSPTFASCQTTLQFAETR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380 3/9 (33%)
leucine-rich repeat 229..252 CDD:275380 1/22 (5%)
LRR_RI <246..433 CDD:238064 57/195 (29%)
LRR_8 251..311 CDD:290566 17/63 (27%)
leucine-rich repeat 253..276 CDD:275380 7/26 (27%)
leucine-rich repeat 277..300 CDD:275380 5/22 (23%)
leucine-rich repeat 301..324 CDD:275380 9/22 (41%)
LRR_8 325..383 CDD:290566 18/57 (32%)
leucine-rich repeat 325..348 CDD:275380 7/22 (32%)
leucine-rich repeat 349..372 CDD:275380 7/22 (32%)
LRR_RI 351..>557 CDD:238064 46/187 (25%)
LRR_8 371..431 CDD:290566 20/64 (31%)
leucine-rich repeat 373..396 CDD:275380 8/27 (30%)
leucine-rich repeat 397..420 CDD:275380 7/22 (32%)
leucine-rich repeat 421..444 CDD:275380 5/22 (23%)
LRR_8 477..536 CDD:290566 16/56 (29%)
leucine-rich repeat 478..502 CDD:275380 5/23 (22%)
leucine-rich repeat 503..526 CDD:275380 8/22 (36%)
Ig <714..761 CDD:299845
LapsynNP_611561.1 leucine-rich repeat 39..59 CDD:275380 6/25 (24%)
LRR_8 58..118 CDD:290566 20/59 (34%)
leucine-rich repeat 60..83 CDD:275380 9/22 (41%)
leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
LRR_RI <94..>249 CDD:238064 42/177 (24%)
LRR_8 106..167 CDD:290566 19/64 (30%)
LRR_4 106..145 CDD:289563 12/39 (31%)
leucine-rich repeat 108..130 CDD:275380 7/22 (32%)
leucine-rich repeat 131..154 CDD:275380 7/22 (32%)
leucine-rich repeat 157..178 CDD:275380 8/25 (32%)
leucine-rich repeat 179..202 CDD:275380 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.