DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16974 and IGFALS

DIOPT Version :9

Sequence 1:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_001139478.1 Gene:IGFALS / 3483 HGNCID:5468 Length:643 Species:Homo sapiens


Alignment Length:665 Identity:162/665 - (24%)
Similarity:240/665 - (36%) Gaps:166/665 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PQIRPRIRTWQEHEFSLLGYKFHLPFVGHAVDSDLDDSDSDEG---------LW-------LDAA 99
            ||..|      |..|.|..|:.|   .|.|:......:....|         .|       |:.|
Human    11 PQFTP------ERRFRLCWYQAH---SGRALLGPPPQASPPAGGLALALLLLSWVALGPRSLEGA 66

  Fly   100 DAGSESVEVEEHELPS--VGHVDPTGNVFKLNCEHVDLRRV-------NQELLSQRSSHINYNQL 155
            |.|:.. |.|....|:  |...|...:...:.|...:|.|:       .|.|....::       
Human    67 DPGTPG-EAEGPACPAACVCSYDDDADELSVFCSSRNLTRLPDGVPGGTQALWLDGNN------- 123

  Fly   156 MLAHVPADRSNPLKLPQLESLREFSWQSSELKDETLMELFTRQPRSFEYMERLNLAENRLECLHW 220
             |:.||     |.....|.||...:.|..:|.        :.:|::...:|.|        | | 
Human   124 -LSSVP-----PAAFQNLSSLGFLNLQGGQLG--------SLEPQALLGLENL--------C-H- 164

  Fly   221 AIPLAVRRVKVLEMSGNRLSNCSLLNLQYMKQLQELHLDRSELTYLPQRFLGELSELRMLNLSQN 285
                       |.:..|:|.:.:|....:...|..|.|..:.|:.|.......|..|..|||..|
Human   165 -----------LHLERNQLRSLALGTFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWN 218

  Fly   286 LLTELPRDIFVGALKLERLYLSGNRLSVLPFMLFQTAADLQVLDLSDNRLLSFPDNFFARNGQLR 350
            .|..||...|.|...|..|.|:||||:.|...||...|:|:.||||.|.|.:...|.|.:..:|:
Human   219 SLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLPRLQ 283

  Fly   351 QLHLQRNQLKSIGKHSLYSLRELRQLDLSQNSLSVIDRKAFESLDHLLALNVSGNNLTLLSSIIF 415
            :|:|.||.:.::...:...|:.||.||||.|.::.:....|..|..|..|.:|.|.:..|....|
Human   284 KLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLRPRTF 348

  Fly   416 QSLHALRQLDLSRNQFKQLPSGLFQRQRSLVLLRIDETPIEQF-----------------SNWIS 463
            :.||.|.:|.|..|:.:||....|:....|.:|.:|...:::.                 .|.:.
Human   349 KDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLR 413

  Fly   464 RYDESL-------------------VDPQV---LHRLRYLSVQQN-------------------- 486
            ...|.:                   :.|..   |..||.|.::.|                    
Human   414 NLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELD 478

  Fly   487 ---RKLTYLPATLFANTPNIRELLLAENGLLQLPTQISG-LSRLQRLSVRGNSLGSLPEN-IKEL 546
               .:||:||..||.....:..|||:.|.|.:||....| |.|...|.|..|.|.:||.: :..|
Human   479 LTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGPLQRAFWLDVSHNRLEALPNSLLAPL 543

  Fly   547 RQLHYLNIL--------------------GNEYQCDCSMYWLTAW-LANTSTSLRHQMPQAQNHS 590
            .:|.||::.                    ||.:.|.|.:..|..: |.|.|...|.    .|...
Human   544 GRLRYLSLRNNSLRTFTPQPPGLERLWLEGNPWDCGCPLKALRDFALQNPSAVPRF----VQAIC 604

  Fly   591 NGSTNQTPLDSYESI 605
            .|...|.|..:|.:|
Human   605 EGDDCQPPAYTYNNI 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380 4/21 (19%)
leucine-rich repeat 229..252 CDD:275380 4/22 (18%)
LRR_RI <246..433 CDD:238064 63/186 (34%)
LRR_8 251..311 CDD:290566 21/59 (36%)
leucine-rich repeat 253..276 CDD:275380 6/22 (27%)
leucine-rich repeat 277..300 CDD:275380 10/22 (45%)
leucine-rich repeat 301..324 CDD:275380 10/22 (45%)
LRR_8 325..383 CDD:290566 22/57 (39%)
leucine-rich repeat 325..348 CDD:275380 9/22 (41%)
leucine-rich repeat 349..372 CDD:275380 6/22 (27%)
LRR_RI 351..>557 CDD:238064 66/289 (23%)
LRR_8 371..431 CDD:290566 21/59 (36%)
leucine-rich repeat 373..396 CDD:275380 9/22 (41%)
leucine-rich repeat 397..420 CDD:275380 7/22 (32%)
leucine-rich repeat 421..444 CDD:275380 7/22 (32%)
LRR_8 477..536 CDD:290566 23/82 (28%)
leucine-rich repeat 478..502 CDD:275380 10/46 (22%)
leucine-rich repeat 503..526 CDD:275380 9/23 (39%)
Ig <714..761 CDD:299845
IGFALSNP_001139478.1 LRRNT 78..116 CDD:214470 6/37 (16%)
leucine-rich repeat 95..113 CDD:275380 3/17 (18%)
leucine-rich repeat 114..137 CDD:275380 7/35 (20%)
leucine-rich repeat 138..161 CDD:275380 4/30 (13%)
LRR_8 141..196 CDD:290566 14/83 (17%)
leucine-rich repeat 162..185 CDD:275380 7/43 (16%)
LRR_8 184..244 CDD:290566 21/59 (36%)
leucine-rich repeat 186..209 CDD:275380 6/22 (27%)
leucine-rich repeat 210..233 CDD:275380 10/22 (45%)
leucine-rich repeat 234..257 CDD:275380 10/22 (45%)
LRR_8 257..316 CDD:290566 22/58 (38%)
leucine-rich repeat 258..281 CDD:275380 9/22 (41%)
leucine-rich repeat 282..305 CDD:275380 6/22 (27%)
leucine-rich repeat 306..324 CDD:275380 7/17 (41%)
LRR_8 336..388 CDD:290566 16/51 (31%)
leucine-rich repeat 354..377 CDD:275380 7/22 (32%)
LRR_8 377..433 CDD:290566 5/55 (9%)
leucine-rich repeat 378..401 CDD:275380 3/22 (14%)
leucine-rich repeat 402..423 CDD:275380 2/20 (10%)
LRR_8 425..484 CDD:290566 6/58 (10%)
leucine-rich repeat 426..447 CDD:275380 1/20 (5%)
leucine-rich repeat 450..473 CDD:275380 4/22 (18%)
leucine-rich repeat 474..497 CDD:275380 6/22 (27%)
LRR_8 476..532 CDD:290566 19/55 (35%)
leucine-rich repeat 498..519 CDD:275380 8/20 (40%)
leucine-rich repeat 522..543 CDD:275380 6/20 (30%)
LRR_8 524..575 CDD:290566 11/50 (22%)
leucine-rich repeat 546..565 CDD:275380 3/18 (17%)
TPKR_C2 574..618 CDD:301599 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.