DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16974 and Islr

DIOPT Version :9

Sequence 1:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster
Sequence 2:XP_006511267.1 Gene:Islr / 26968 MGIID:1349645 Length:436 Species:Mus musculus


Alignment Length:461 Identity:94/461 - (20%)
Similarity:137/461 - (29%) Gaps:185/461 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 ADLQVLDLSDNRLLSFPDNFFARNGQLRQLHLQRNQLKSIGKHSLYSLRELRQLDLSQNSLSVID 387
            |::..|.||.|||...|:..|.....|:.|.|..|:::|:...:|..|..|:.||||.|.||...
Mouse    58 ANVTTLSLSANRLPGLPEGAFREVPLLQSLWLAHNEIRSVAIGALAPLSHLKSLDLSHNLLSEFA 122

  Fly   388 RKAFESLDHLLALNVSGNNLTLLSSIIFQSLHALRQLDLSRNQFKQLPSGLFQRQRSLVLLRIDE 452
            .....:|..|..|.:..|.|..:....|.||.|||.|.|:.|:...|..|               
Mouse   123 WSDLHNLSALQLLKMDSNELAFIPRDAFSSLSALRSLQLNHNRLHALAEG--------------- 172

  Fly   453 TPIEQFSNWISRYDESLVDPQVLHRLRYLSVQQNRKLTYLPATLFANTPNIRELLLAENGLLQLP 517
                                                 |:.|.|                      
Mouse   173 -------------------------------------TFAPLT---------------------- 178

  Fly   518 TQISGLSRLQRLSVRGNSLGSLPENIKELRQLHYLNILGNEYQCDCSMYWLTAWLANTSTSLRHQ 582
                                          .|.:|.|..|.:.|.|.:.|...|...::.|:..|
Mouse   179 ------------------------------ALSHLQINDNPFDCTCGIVWFKTWALASAVSIPEQ 213

  Fly   583 MPQAQNHSNGSTNQTPLDSYESIDHQIDALKC--QYGYRGDMLRVLSKLNCSVPTVVQFSEPKMH 645
                                       |.:.|  .:..:|..|..|..|.||.|:|....:|...
Mouse   214 ---------------------------DNIACTTPHVLKGIPLGRLPPLPCSAPSVQLSYQPSQD 251

  Fly   646 K-------LLSTAKLECQISGSPVPDIIWVTPRNKILRHHADPDKRPIIIDSKEDAHQPPSAQEL 703
            .       :|:   |.|.:.|.|||.:.|                         ..|.|....|:
Mouse   252 GAELRPGFVLA---LHCDVDGQPVPQLHW-------------------------HIHTPGGTVEI 288

  Fly   704 AALMDESYIQSLN-WTRQNSLVGR-------RVVLVENGSLLVHNISRIDSGLYTCYAFNVMGKA 760
            |         |.| .|...:|.|.       |.....|||||:.:..:::.|.|:|.|.|.:|.|
Mouse   289 A---------SPNVGTDGRALPGALATSGQPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSA 344

  Fly   761 SAGLRL 766
            .:.:.:
Mouse   345 ESSVNV 350

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_RI <246..433 CDD:238064 38/109 (35%)
LRR_8 251..311 CDD:290566
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380