DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16974 and LINGO2

DIOPT Version :9

Sequence 1:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_001245211.1 Gene:LINGO2 / 158038 HGNCID:21207 Length:606 Species:Homo sapiens


Alignment Length:669 Identity:153/669 - (22%)
Similarity:232/669 - (34%) Gaps:183/669 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RLECLHWAIPLAVRRVKVLEMSGNRLSNCSLLNLQYMKQLQELHLDRSELTYLPQRFLGELSELR 278
            ||..:...||:   ..|:|::|.|||.:.:                       |:.|: ....|.
Human    47 RLIAIPEGIPI---ETKILDLSKNRLKSVN-----------------------PEEFI-SYPLLE 84

  Fly   279 MLNLSQNLLTELPRDIFVGALKLERLYLSGNRLSVLPFMLFQTAADLQVLDLSDNRLLSFPDNFF 343
            .::||.|::..:....|.....|..|.|.||||.::|..:|...::|..||:|:|:::...|..|
Human    85 EIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMF 149

  Fly   344 ARNGQLRQLHLQRNQLKSIGKHSLYSLRELRQLDLSQNSLSVIDRKAFESLDHLLALNVSGNNLT 408
                  :.||                  .|:.|::..|.|..|..:||..|..|..|.:...|||
Human   150 ------QDLH------------------NLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLT 190

  Fly   409 LLSSIIFQSLHALRQLDLSRNQFKQLPSGLFQRQRSLVLLRIDETPIEQFSNWISRYDESLVDPQ 473
            .:.:.....|.:|..|.|.......:|...|:|...|..|.||..|:.......|.|..:|....
Human   191 AVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLS 255

  Fly   474 VLH---------RLRYLSVQQNRKLTYLP-----ATLFANTPNIRELLLAENGLLQL-PTQISGL 523
            |.:         ..::|....:..|:|.|     |.:|::...::||.:....|..: |....||
Human   256 VTNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGL 320

  Fly   524 SRLQRLSVRGNSLGSLPENI-KELRQLHYLNILGNEYQCDCSMYWLTAWLANTSTSLRHQMPQA- 586
            ..|:.|:|..|.|.:|.||: ...|.|..|:|..|...|||.:.|:..  ...:.....|.|.. 
Human   321 RFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQ--RQPTLQFGGQQPMCA 383

  Fly   587 -----QNHSNGSTNQTPLDSYESIDHQIDALKCQYGYRGDMLRVLSKLNCSVPTVVQFSEPKMHK 646
                 :..|....:.|.|..|                          ..|..|.:   .|.|:..
Human   384 GPDTIRERSFKDFHSTALSFY--------------------------FTCKKPKI---REKKLQH 419

  Fly   647 LL----STAKLECQISGSPVPDIIWVTPRNKILRHHADPDKRPIIIDSKEDAHQPPSAQELAALM 707
            ||    .|.:|||...|.|.|.|.|||||.:.:.                               
Human   420 LLVDEGQTVQLECSADGDPQPVISWVTPRRRFIT------------------------------- 453

  Fly   708 DESYIQSLNWTRQNSLVGRRVVLVENGSLLVHNISRIDSGLYTCYAFNVMG----------KASA 762
                      |:.|   ||..|| .:|:|.:......|||:|.|.|.|..|          |..|
Human   454 ----------TKSN---GRATVL-GDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFA 504

  Fly   763 GLR-LYIDPIVFYRVKIGSILFGTALATAFL--LLTLIVQGLRSCLSRWGICNRFYCCV------ 818
            ..| ||.:....|.......:.....|..|.  |.|::|.....|.:..|:.  .:|.:      
Human   505 SDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKTILVSTAMGCFTFLGVV--LFCFLLLFVWS 567

  Fly   819 ---NRKKKS------PRKH 828
               .:.|.|      |||:
Human   568 RGKGKHKNSIDLEYVPRKN 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380 4/13 (31%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR_RI <246..433 CDD:238064 42/186 (23%)
LRR_8 251..311 CDD:290566 12/59 (20%)
leucine-rich repeat 253..276 CDD:275380 2/22 (9%)
leucine-rich repeat 277..300 CDD:275380 5/22 (23%)
leucine-rich repeat 301..324 CDD:275380 9/22 (41%)
LRR_8 325..383 CDD:290566 12/57 (21%)
leucine-rich repeat 325..348 CDD:275380 7/22 (32%)
leucine-rich repeat 349..372 CDD:275380 2/22 (9%)
LRR_RI 351..>557 CDD:238064 55/221 (25%)
LRR_8 371..431 CDD:290566 17/59 (29%)
leucine-rich repeat 373..396 CDD:275380 8/22 (36%)
leucine-rich repeat 397..420 CDD:275380 6/22 (27%)
leucine-rich repeat 421..444 CDD:275380 6/22 (27%)
LRR_8 477..536 CDD:290566 16/64 (25%)
leucine-rich repeat 478..502 CDD:275380 6/28 (21%)
leucine-rich repeat 503..526 CDD:275380 6/23 (26%)
Ig <714..761 CDD:299845 17/56 (30%)
LINGO2NP_001245211.1 LRRNT 27..60 CDD:214470 4/15 (27%)
leucine-rich repeat 39..57 CDD:275380 3/9 (33%)
LRR 1 58..79 8/44 (18%)
leucine-rich repeat 59..82 CDD:275380 8/46 (17%)
LRR_8 60..117 CDD:316378 18/80 (23%)
LRR 2 82..103 5/20 (25%)
leucine-rich repeat 83..106 CDD:275380 5/22 (23%)
LRR_8 106..165 CDD:316378 21/82 (26%)
LRR 3 106..127 9/20 (45%)
leucine-rich repeat 107..130 CDD:275380 9/22 (41%)
LRR 4 130..151 7/26 (27%)
leucine-rich repeat 131..154 CDD:275380 9/46 (20%)
LRR_5 146..276 CDD:331043 34/153 (22%)
LRR 5 154..175 7/20 (35%)
leucine-rich repeat 155..178 CDD:275380 8/22 (36%)
LRR 6 178..199 5/20 (25%)
leucine-rich repeat 179..202 CDD:275380 6/22 (27%)
LRR 7 202..223 5/20 (25%)
leucine-rich repeat 203..250 CDD:275380 13/46 (28%)
LRR 8 226..247 6/20 (30%)
LRR_8 250..309 CDD:316378 10/58 (17%)
LRR 9 250..271 2/20 (10%)
leucine-rich repeat 251..274 CDD:275380 3/22 (14%)
LRR 10 274..295 5/20 (25%)
leucine-rich repeat 275..298 CDD:275380 5/22 (23%)
LRR_8 298..357 CDD:316378 19/58 (33%)
LRR 11 298..319 4/20 (20%)
leucine-rich repeat 299..322 CDD:275380 6/22 (27%)
LRR 12 322..343 8/20 (40%)
leucine-rich repeat 323..343 CDD:275380 8/19 (42%)
PCC 327..>391 CDD:188093 17/65 (26%)
I-set 410..500 CDD:254352 34/137 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D195414at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.