DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and AT1G21920

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_173610.1 Gene:AT1G21920 / 838794 AraportID:AT1G21920 Length:417 Species:Arabidopsis thaliana


Alignment Length:174 Identity:63/174 - (36%)
Similarity:84/174 - (48%) Gaps:26/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YIGGRNAA----GQRQGRG---WAILPNGDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRC 84
            ::.||...    |:..|.|   ||   .|.:|.|.||:|.|||.|||.|..|..|.|::..|:..
plant   197 FVRGRYEGDWLDGRYDGHGIESWA---RGSRYKGQYRQGLRHGFGVYRFYTGDCYAGEWFNGQSH 258

  Fly    85 GRGIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVGIYHFNSGKDGCCLSVR 149
            |.|:....|||.|.|..|..:|||.|.|.:.|||.|:|::|..:.||.|:|.|.:|.   |    
plant   259 GFGVQSCSDGSSYLGESRFGVKHGLGSYHFRNGDKYAGEYFGDKIHGFGVYRFANGH---C---- 316

  Fly   150 MKATWNSNMRTGPFELY-IGNEDKCTILHGIWDNLYPSGPAVFS 192
            .:..|:...:.| |..| ..|.|..:   |.||    ||..|.|
plant   317 YEGAWHEGRKQG-FGAYSFRNGDAKS---GEWD----SGVLVTS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 13/21 (62%)
MORN 72..93 CDD:197832 5/20 (25%)
MORN 95..116 CDD:197832 9/20 (45%)
MORN 118..137 CDD:197832 8/18 (44%)
AT1G21920NP_173610.1 PLN03185 169..>348 CDD:215619 60/168 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23084
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.