DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and AT4G17080

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_193441.5 Gene:AT4G17080 / 827416 AraportID:AT4G17080 Length:513 Species:Arabidopsis thaliana


Alignment Length:130 Identity:48/130 - (36%)
Similarity:70/130 - (53%) Gaps:13/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GQRQGRG---WAILPNGDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSV 96
            |:..|.|   ||   .|.:|.|.||:|.|||.|:|.|..|..|.|::..|:..|.|::...|||.
plant   292 GKYDGYGVETWA---KGSRYRGQYRQGMRHGTGIYRFYTGDVYAGEWSNGQSHGCGVYTSEDGSR 353

  Fly    97 YEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTG 161
            :.|.::..:|||.|.|.:.|||.|:|::|..:.||.|:|.|.:|.       |.:..|:...|.|
plant   354 FVGEFKWGVKHGLGHYHFRNGDTYAGEYFADRMHGFGVYQFGNGH-------RYEGAWHEGRRQG 411

  Fly   162  161
            plant   412  411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 12/21 (57%)
MORN 72..93 CDD:197832 5/20 (25%)
MORN 95..116 CDD:197832 7/20 (35%)
MORN 118..137 CDD:197832 8/18 (44%)
AT4G17080NP_193441.5 EcfT 156..>219 CDD:410987
PLN03185 256..>415 CDD:215619 48/130 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23084
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.