DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and PIP5K5

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_181654.1 Gene:PIP5K5 / 818720 AraportID:AT2G41210 Length:772 Species:Arabidopsis thaliana


Alignment Length:337 Identity:87/337 - (25%)
Similarity:135/337 - (40%) Gaps:80/337 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ILPNGDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYE---------- 98
            :|||||.|.|.:.....||.|.|::.||..|.|.:..||..|.|.|.:|.|:.||          
plant    68 VLPNGDYYTGQWYDSFPHGHGKYLWTDGCMYIGDWYNGKTMGNGKFGWPSGATYEGEFKSGYMDG 132

  Fly    99 -------------GNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVGIYHFNSG-------KDG 143
                         |.|..|||||.|...:.|||.|.|:|.:|.:.|.|.|.::.|       |:|
plant   133 IGTYTGPSGDAYKGQWVMNLKHGHGVKSFANGDAYDGEWRRGLQEGQGKYQWSDGSYYIGEWKNG 197

  Fly   144 CCLSVRMKATWNSNMRTGPFELYIGNEDKCTILHGIWDNLYPSGPAVFSFNNRYLLLGYFLPASY 208
            ....            .|.|....||.     ..|.||..:|.|...|.::|....:|::.....
plant   198 TICG------------KGSFVWTNGNR-----YDGFWDEGFPRGNGTFKWDNGSFYVGHWSKDPE 245

  Fly   209 NMKAI----SNEDEMEDAEERLEDEMGE----AEPMEPTLWFAQEMAVYDFSLLPQEPVPLAISD 265
            .|...    .||..:|...:.|.:.:.|    :....|||...::::|::.|...::|...:: |
plant   246 EMNGTYYPSGNEGNLEWDPKDLFNNLSEYTICSGERVPTLPSQKKLSVWNSSKRIEKPRRTSV-D 309

  Fly   266 SELSVCSLSTEPSMRSEEKISWYGEGEEAEGEEGGEMECFPCECDLTDVSEVETESEVCKIDANP 330
            ..:||      ...|:.||::.:|   ...||.|.:|             ..|.::|:.::||..
plant   310 GRVSV------GVDRAFEKMNMWG---NEIGEGGADM-------------RKELDAELMRLDAEG 352

  Fly   331 CCIEILKQPECP 342
              ::.||....|
plant   353 --LQSLKSSPVP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 8/21 (38%)
MORN 72..93 CDD:197832 7/20 (35%)
MORN 95..116 CDD:197832 10/43 (23%)
MORN 118..137 CDD:197832 8/18 (44%)
PIP5K5NP_181654.1 PLN03185 66..768 CDD:215619 87/337 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.