DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and PIP5K3

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001324179.1 Gene:PIP5K3 / 817182 AraportID:AT2G26420 Length:719 Species:Arabidopsis thaliana


Alignment Length:313 Identity:86/313 - (27%)
Similarity:123/313 - (39%) Gaps:57/313 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MTEMSEEDLSAP-EEEEDLGPNIGLYIGGRNAAGQRQGRGWAILPNGDQYDGNYRKGRRHGIGVY 66
            ||.....|.:|. ...|.:..|..||.||. :||...|.|..:..:|..|:|.:.:|:..|.|.:
plant    33 MTSCEVSDTAAEIRIVEKVLKNGDLYNGGL-SAGVPHGTGKYLWSDGCMYEGEWTRGKASGKGRF 96

  Fly    67 VFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHG 131
            .:..|:.|.||::.|:..|.|.||..||..|.|:|....|||.|..:|.|||.|.|:|....:.|
plant    97 SWPSGATYEGQFKDGRMDGEGTFIGIDGDTYRGHWLWGRKHGYGEKRYANGDGYQGNWKANLQDG 161

  Fly   132 VGIYHFNSG-------KDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTILHGIWDNLYPSGPA 189
            .|.|.::.|       |:| .:|.:.|.||.:..|                ..|:|:|..|.|..
plant   162 NGRYVWSDGNEYVGEWKNG-VISGKGKMTWANGNR----------------YDGLWENGAPVGKG 209

  Fly   190 VFSFNNRYLLLGYFLPASYNMKAISNEDEMEDAEERLEDEMGEAEPMEPTLWFAQEMAVYDFSLL 254
            |.|:...        ..|||  ....:.:.:|.|.....::...|.:.....|.:          
plant   210 VLSWGEE--------KTSYN--GWGRKSKKKDEEIVQNHKLSSVETLSANTNFPR---------- 254

  Fly   255 PQEPVPLAISDSE-LSVCSLSTEPSMRSEEKISWYGEGEEAEG----EEGGEM 302
                  :.||:.| ..||.........||...|..||.|.|..    |.||.|
plant   255 ------ICISELEDTGVCDHVEASPYTSESDTSGCGEQEWARSPLLLESGGAM 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 6/21 (29%)
MORN 72..93 CDD:197832 8/20 (40%)
MORN 95..116 CDD:197832 8/20 (40%)
MORN 118..137 CDD:197832 7/18 (39%)
PIP5K3NP_001324179.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.