DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and MORN1

DIOPT Version :10

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_079124.1 Gene:MORN1 / 79906 HGNCID:25852 Length:497 Species:Homo sapiens


Alignment Length:104 Identity:24/104 - (23%)
Similarity:41/104 - (39%) Gaps:22/104 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LLCLLFLEISSNGLEEVQSLTFQNLNQLKNLKLNNNRIPALLDGVFHGLIAIGTLELNNNSISTI 174
            |.|.||.:..|.             :..|:.|..::..|.|..|||..::.:|   ::.:.:|  
Human     2 LSCPLFKDYLSE-------------DDFKSSKGGSHCFPELRVGVFEEIVPMG---ISPSQVS-- 48

  Fly   175 HKGGFFNLTSLTNLGLAHNRIEEIEQSGWEFTPKLISLD 213
            :|....:|:.    |..|..||::.....|.....|.||
Human    49 YKKPGIHLSP----GEFHKEIEKLLSQSSEEQGNTIILD 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 COG4642 <14..141 CDD:443680 6/30 (20%)
MORN1NP_079124.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 7/37 (19%)
COG4642 <5..207 CDD:443680 22/101 (22%)
MORN 1 39..61 5/30 (17%)
MORN 2 62..84 7/22 (32%)
MORN 3 86..108
MORN 4 109..131
MORN 5 132..154
MORN 6 155..177
MORN 7 178..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..425
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 468..497
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.