| Sequence 1: | NP_609609.1 | Gene: | Rsph1 / 34712 | FlyBaseID: | FBgn0032478 | Length: | 344 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001070227.1 | Gene: | rsph10b / 767792 | ZFINID: | ZDB-GENE-060929-300 | Length: | 731 | Species: | Danio rerio |
| Alignment Length: | 219 | Identity: | 56/219 - (25%) |
|---|---|---|---|
| Similarity: | 78/219 - (35%) | Gaps: | 58/219 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 TEMSEEDLSAPEEEEDLG-------------PNIGLYIG--------------------GRNAAG 35
Fly 36 QRQGRGWAILPNGDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGN 100
Fly 101 WRKNLKHGKGRYKYVNG-DNYSGDWFKGQRHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTGPFE 164
Fly 165 LYIGNEDKCTILHGIW-DNLYPSG 187 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Rsph1 | NP_609609.1 | MORN | 51..73 | CDD:280628 | 9/21 (43%) |
| MORN | 72..93 | CDD:197832 | 4/20 (20%) | ||
| MORN | 95..116 | CDD:197832 | 9/20 (45%) | ||
| MORN | 118..137 | CDD:197832 | 7/18 (39%) | ||
| rsph10b | NP_001070227.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..69 | 9/39 (23%) | |
| MORN 1 | 86..108 | 5/21 (24%) | |||
| MORN 2 | 109..131 | 9/21 (43%) | |||
| MORN | 109..129 | CDD:280628 | 7/19 (37%) | ||
| MORN 3 | 132..154 | 5/21 (24%) | |||
| MORN 4 | 155..177 | 9/21 (43%) | |||
| MORN 5 | 179..201 | 8/21 (38%) | |||
| COG4642 | 194..334 | CDD:226989 | 11/54 (20%) | ||
| MORN 6 | 204..226 | 10/39 (26%) | |||
| MORN | 225..246 | CDD:197832 | 56/219 (26%) | ||
| MORN 7 | 227..249 | ||||
| MORN 8 | 251..273 | ||||
| MORN 9 | 284..306 | ||||
| MORN 10 | 307..329 | ||||
| MORN | 307..327 | CDD:280628 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 353..377 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 709..731 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG4642 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1309439at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||