DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and Morn5

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_083585.1 Gene:Morn5 / 75495 MGIID:1922745 Length:170 Species:Mus musculus


Alignment Length:157 Identity:40/157 - (25%)
Similarity:62/157 - (39%) Gaps:24/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHGKGRY 112
            |.||.|.|..||..|...|:....:||.|:.:.|...|.|...:|.||.::..|:|.|. .||:|
Mouse     5 GSQYFGEYINGRMEGSAEYILPTDTRYIGEMKDGMFHGEGTLFFPSGSRFDAIWKKGLV-VKGKY 68

  Fly   113 KYVNGDNYSGDWFKGQRHGVGIYHFNSGKD-----GCCLSVRMKATWNSNMRTGPFELYIGNEDK 172
            .:.:|..|.      .:|    :|:....|     ..|..::............|..:.:|..| 
Mouse    69 TFNDGLQYE------DKH----WHYCDSYDRRFYTEICYGLKPSGISQLTNMDPPRRIPLGYYD- 122

  Fly   173 CTILHGIWDNLY-PSGPAVFSFNNRYL 198
            |      .|..| |:...:..:.||:|
Mouse   123 C------GDGFYNPTTRVIKDYRNRFL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 7/21 (33%)
MORN 72..93 CDD:197832 6/20 (30%)
MORN 95..116 CDD:197832 7/20 (35%)
MORN 118..137 CDD:197832 2/18 (11%)
Morn5NP_083585.1 COG4642 <5..77 CDD:226989 25/72 (35%)
MORN 1 8..30 7/21 (33%)
MORN 31..53 CDD:280628 7/21 (33%)
MORN 2 31..53 7/21 (33%)
MORN 3 54..75 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.