DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and Morn3

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_083388.1 Gene:Morn3 / 74890 MGIID:1922140 Length:241 Species:Mus musculus


Alignment Length:288 Identity:66/288 - (22%)
Similarity:95/288 - (32%) Gaps:97/288 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRNAAGQRQG-RGWAILPNGDQYDGNYRKGRRHGIGVYVF-KDGSRYYGQYRCGKRCGRGIFIYP 92
            |.:...|:.| |......|||.|.|.::...:||.|..|: |.|:.|.|.::.|||.|.|...:|
Mouse    16 GWDRKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHP 80

  Fly    93 DGSV-----------------------------YEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQ 128
            |...                             |||.|..|.:.|.||..|.|||.|.|.|...:
Mouse    81 DPETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDK 145

  Fly   129 RHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTILHGIW-DNLYPSGPAVFS 192
            ..|.|:....:|.       |.:..|...|:.|....:  :.|...:..|.| ||:...|..:  
Mouse   146 PEGEGMLRLKNGN-------RYEGIWERGMKNGHGRFF--HLDHGQLFEGYWVDNVAKCGTMI-- 199

  Fly   193 FNNRYLLLGYFLPASYNMKAISNEDEMEDAEERLEDEMGEAEPMEPTLWFAQEMAVYDFSLLPQE 257
                                                :.|..|..|||                |.
Mouse   200 ------------------------------------DFGRDEAPEPT----------------QF 212

  Fly   258 PVP-LAISDSELSVCSLSTEPSMRSEEK 284
            |:| :.|.|.: .|...:.:..|:.||:
Mouse   213 PIPKVEILDPD-GVLKEALDKLMKPEEE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 8/22 (36%)
MORN 72..93 CDD:197832 7/20 (35%)
MORN 95..116 CDD:197832 9/49 (18%)
MORN 118..137 CDD:197832 6/18 (33%)
Morn3NP_083388.1 PLN03185 34..>190 CDD:215619 45/164 (27%)
MORN 1 38..60 7/21 (33%)
MORN 2 62..84 9/21 (43%)
MORN 3 91..113 0/21 (0%)
MORN 4 114..136 11/21 (52%)
MORN 5 137..159 6/28 (21%)
MORN 6 160..182 4/23 (17%)
MORN 7 184..205 6/58 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.