DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and Morn3

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_038946061.1 Gene:Morn3 / 687615 RGDID:1583091 Length:269 Species:Rattus norvegicus


Alignment Length:193 Identity:53/193 - (27%)
Similarity:75/193 - (38%) Gaps:41/193 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRNAAGQRQG-RGWAILPNGDQYDGNYRKGRRHGIGVYVFK-DGSRYYGQYRCGKRCGRGIFIYP 92
            |.:...|:.| |......|||.|.|.::...:||.|..|:| .|:.|.|.::.|||.|.||..:|
  Rat    44 GWDQKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKQSGAMYEGDWKFGKRDGYGILSHP 108

  Fly    93 DGSV-----------------------------YEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQ 128
            |...                             |||.|..|.:.|.||..|.|||.|.|.|...:
  Rat   109 DPETGKLKRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCSNQRSGWGRMYYNNGDIYEGQWKNDK 173

  Fly   129 RHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTILHGIW-DNLYPSGPAV 190
            ..|.|:....:|.       |.:.:|...|:.|....:  :.|...:..|.| ||:...|..:
  Rat   174 PDGEGMLRLKNGN-------RYEGSWERGMKNGHGRFF--HLDHGQLFEGFWVDNVAKCGTMI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 8/22 (36%)
MORN 72..93 CDD:197832 8/20 (40%)
MORN 95..116 CDD:197832 9/49 (18%)
MORN 118..137 CDD:197832 6/18 (33%)
Morn3XP_038946061.1 PLN03185 62..>216 CDD:215619 45/162 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.