DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and jph1b

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001037813.1 Gene:jph1b / 556485 ZFINID:ZDB-GENE-060616-389 Length:673 Species:Danio rerio


Alignment Length:337 Identity:80/337 - (23%)
Similarity:119/337 - (35%) Gaps:109/337 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GLYIGGRNAAGQRQGRGWAILPNGD-QYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGI 88
            |.:.||.. .|:..|.|....|.|. :|.|::..| ...:|||.:..|:.|.|.:..|||.|.|:
Zfish    12 GTFCGGWE-DGKAHGHGICTGPKGQGEYSGSWSNG-FEVVGVYTWPSGNTYKGYWAQGKRHGLGV 74

  Fly    89 -----FIY--------------------PDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQ 128
                 ::|                    |  :.|||.|...|:.|.|...|.:|..|.|.|..|.
Zfish    75 ESKGRWLYRGEWSHGFKGRYGVRQSLNTP--ARYEGTWSNGLQDGYGVETYGDGGTYQGQWMGGM 137

  Fly   129 RHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTILHGIWDNLYPS-----GP 188
            |||.|:.  .|...|....:|      |.:||....|. ..:...::||   |::..|     |.
Zfish   138 RHGYGVR--QSVPYGMATVIR------SPLRTSLASLR-SEQSNGSVLH---DHMSDSPAGTRGG 190

  Fly   189 AVFSFNNRYLLLGYFLPASYNMKAISNEDEMEDAEERLEDEMGEAEPMEPTLWFAQEMAVYDFSL 253
            .|.:|:                    ::.|:...:::.....|..                 |..
Zfish   191 FVLNFH--------------------SDSEVVSGKKKGLFRRGSL-----------------FGS 218

  Fly   254 LPQEPVPLAISDSELSVCSLSTEPSMRSEEKIS-----------WYGEGEEAEGEEGGEMECFPC 307
            |.|    |..|||..|:.  |...|.||:..:|           .:|:||.|:       |..|.
Zfish   219 LKQ----LRKSDSRSSIS--SKRSSARSDATMSRISSSDANSTISFGDGEVAD-------EYMPA 270

  Fly   308 ECDLTDVSEVET 319
            | |..|.:..|:
Zfish   271 E-DNVDATTTES 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 7/21 (33%)
MORN 72..93 CDD:197832 8/45 (18%)
MORN 95..116 CDD:197832 8/20 (40%)
MORN 118..137 CDD:197832 8/18 (44%)
jph1bNP_001037813.1 MORN 106..128 CDD:280628 9/21 (43%)
MORN 305..327 CDD:280628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.