DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and morn5

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_021334849.1 Gene:morn5 / 554117 ZFINID:ZDB-GENE-050522-267 Length:206 Species:Danio rerio


Alignment Length:178 Identity:52/178 - (29%)
Similarity:73/178 - (41%) Gaps:37/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNL-KHGKGR 111
            |..|||:|..||..|.|.|.....:||.|:.:.|...|:|:..:|:||.|||.|.|.: |.||  
Zfish     5 GSSYDGDYNNGRMEGTGEYTIPTHTRYVGEMKDGMFHGKGVLHFPNGSKYEGTWEKGICKEGK-- 67

  Fly   112 YKYVNGDNY-SGDWFKGQRHGVGIYHFNSGKDGCCLSVR---MKATWNSNMRTGPFELYIGNEDK 172
            |.:.:|..| ..||           .:..|||....|.|   :|....|.: |.|        |.
Zfish    68 YTFSDGLKYKETDW-----------DYCDGKDRRFYSERCNGLKPAGESQL-TDP--------DP 112

  Fly   173 CTILHGIWDNLYPSGPAVFSFNNRYLLLGYFLPASYNMKAISNEDEME 220
            ..:   |.|..|.:|...:..|.|.:       ..|:...:.|.|:.|
Zfish   113 PRV---IPDGCYDTGDGFYDPNTRVV-------KGYDGNFLRNADDQE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 9/21 (43%)
MORN 72..93 CDD:197832 6/20 (30%)
MORN 95..116 CDD:197832 10/21 (48%)
MORN 118..137 CDD:197832 3/19 (16%)
morn5XP_021334849.1 COG4642 5..>76 CDD:332236 29/72 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.