DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and morn4

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001017559.1 Gene:morn4 / 550131 ZFINID:ZDB-GENE-050417-7 Length:146 Species:Danio rerio


Alignment Length:104 Identity:36/104 - (34%)
Similarity:56/104 - (53%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RGWAILPNGDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGNWRKN 104
            ||.....:|::|.|.:::|||||.|...|.||:.|.|.:..|...|.|:.::||||.|||.:.:.
Zfish     5 RGSFTYSSGEEYTGEWKEGRRHGKGELKFADGTCYKGHFENGLFHGSGVLVFPDGSRYEGEFAQG 69

  Fly   105 LKHGKGRYKYVNGDNYSGDWFKGQRHGVGIYHFNSGKDG 143
            ...|.|.:...:|..:.|::..|:..|.|:..|..|..|
Zfish    70 KFQGVGIFSRFDGMKFEGEFKSGRVEGHGLLTFPDGSHG 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 11/21 (52%)
MORN 72..93 CDD:197832 5/20 (25%)
MORN 95..116 CDD:197832 6/20 (30%)
MORN 118..137 CDD:197832 4/18 (22%)
morn4NP_001017559.1 COG4642 6..123 CDD:226989 35/103 (34%)
MORN 16..37 CDD:280628 10/20 (50%)
MORN 39..61 CDD:280628 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.