DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and morn5

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001016143.1 Gene:morn5 / 548897 XenbaseID:XB-GENE-958918 Length:178 Species:Xenopus tropicalis


Alignment Length:81 Identity:27/81 - (33%)
Similarity:39/81 - (48%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHG---K 109
            |.:|.|....||..|.|.|:....:||.|:.:.|...|:|...:|:||.|...|    .||   :
 Frog     5 GSEYKGERLHGRLEGKGEYILPTETRYEGEMKDGMFHGQGTLFFPNGSKYVALW----DHGIALQ 65

  Fly   110 GRYKYVNGDNY-SGDW 124
            |:|.:.:|..| ..||
 Frog    66 GKYTFADGLEYDKEDW 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 7/21 (33%)
MORN 72..93 CDD:197832 6/20 (30%)
MORN 95..116 CDD:197832 7/23 (30%)
MORN 118..137 CDD:197832 3/8 (38%)
morn5NP_001016143.1 PLN03185 4..>82 CDD:215619 27/81 (33%)
MORN 1 8..30 7/21 (33%)
MORN 2 31..53 7/21 (33%)
MORN 3 54..75 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.