DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and Jph3

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001100907.1 Gene:Jph3 / 307916 RGDID:1308416 Length:749 Species:Rattus norvegicus


Alignment Length:321 Identity:70/321 - (21%)
Similarity:107/321 - (33%) Gaps:74/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GLYIGGRNAAGQRQGRGWAILPNGDQYDGNYRKGRRHG---IGVYVFKDGSRYYGQYRCGKRCG- 85
            |.|.||.. .|:..|.|....|.|   .|.|.....||   :|||.:..|:.|.|.:..|||.| 
  Rat    13 GSYCGGWE-DGKAHGHGVCTGPKG---QGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGI 73

  Fly    86 ----RGIFIYP------------------DGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQ 128
                :|.::|.                  :|:.|||.|...|:.|.|...|.:|..|.|.|..|.
  Rat    74 GLESKGKWVYKGEWTHGFKGRYGVRECTGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGM 138

  Fly   129 RHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTILHGIWDNLYPSGPAVF-- 191
            |.|.|:..        .:...|.|...|.:||....|. ........||..........|||.  
  Rat   139 RQGYGVRQ--------SVPYGMAAVIRSPLRTSINSLR-SEHTNGAALHPDASPAVAGSPAVSRG 194

  Fly   192 ------------------SFNNRYLLLGYFLPASYNMKAISNEDEMED---AEERLEDEMGEAEP 235
                              ....|.||.|..|..|.:..:::::...:.   :|..:......|..
  Rat   195 GFVLVAHSDSEILKSKKKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASD 259

  Fly   236 MEPTLWFAQEMAVYDFSLLPQEPVPLAISDSELSVCSLSTEPSMRSEEKISWYGEGEEAEG 296
            :..|:            .|.:....||:.:.::...:..|.......:|.|.:|..:.::|
  Rat   260 IHSTI------------SLGEAEAELAVIEDDIDATTTETYVGEWKNDKRSGFGVSQRSDG 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 8/24 (33%)
MORN 72..93 CDD:197832 8/43 (19%)
MORN 95..116 CDD:197832 8/20 (40%)
MORN 118..137 CDD:197832 7/18 (39%)
Jph3NP_001100907.1 MORN 15..35 CDD:280628 7/20 (35%)
MORN 107..129 CDD:280628 9/21 (43%)
MORN 311..333 CDD:280628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.