DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and Jph1

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001100100.1 Gene:Jph1 / 297748 RGDID:1308789 Length:660 Species:Rattus norvegicus


Alignment Length:330 Identity:80/330 - (24%)
Similarity:121/330 - (36%) Gaps:96/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GLYIGGRNAAGQRQGRGWAILPNGD-QYDGNYRKGRRHG---IGVYVFKDGSRYYGQYRCGKRCG 85
            |.|.||.. .|:..|.|....|.|. :|.|::    .||   :|.|.:..|:.|.|.:..|||.|
  Rat    12 GTYCGGWE-EGKAHGHGICTGPKGQGEYSGSW----SHGFEVVGGYTWPSGNTYQGYWAQGKRHG 71

  Fly    86 RGI-----FIY--------------------PDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWF 125
            .|:     ::|                    |  :.|||.|...|:.|.|...|.:|..|.|.|.
  Rat    72 LGVETKGKWMYRGEWSHGFKGRYGVRQSLCTP--ARYEGTWSNGLQDGYGVETYGDGGTYQGQWA 134

  Fly   126 KGQRHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTILH----GIWDNLYPS 186
            .|.|||.|:.  .|...|....:|      |.:||....|. ..:...::||    ...||  |:
  Rat   135 GGMRHGYGVR--QSVPYGMATVIR------SPLRTSLASLR-SEQSNGSVLHEAAAAAADN--PA 188

  Fly   187 GPAVFSFNNRYLLLGYFLPASYNMKAISNEDEMEDAEERLEDEMGEAEPMEPTLWFAQEMAVY-D 250
            |..           |.|:   .|..|              :.|:|:           ::..:: .
  Rat   189 GTR-----------GGFV---LNFHA--------------DTELGK-----------KKSGLFRR 214

  Fly   251 FSLLPQEPVPLAISDSELSVCSLSTEPSMRSEEKISWYGEGEEAEGEEGGEMECFPCEC-DLTDV 314
            .|||..  :.|..|:|:.|:.  |...|:||:..:|.....:.......|:::|..|.. |..|.
  Rat   215 GSLLGS--MKLRKSESKSSIS--SKRSSVRSDAAMSRISSSDANSTISFGDVDCDFCPVEDHVDA 275

  Fly   315 SEVET 319
            :..||
  Rat   276 TTTET 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 7/24 (29%)
MORN 72..93 CDD:197832 8/45 (18%)
MORN 95..116 CDD:197832 8/20 (40%)
MORN 118..137 CDD:197832 8/18 (44%)
Jph1NP_001100100.1 PLN03185 4..>143 CDD:215619 41/137 (30%)
PLN03185 106..>325 CDD:215619 55/229 (24%)
PspC_subgroup_2 <410..621 CDD:411408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.