DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and Rsph10b

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_006248920.1 Gene:Rsph10b / 288478 RGDID:1311893 Length:906 Species:Rattus norvegicus


Alignment Length:370 Identity:76/370 - (20%)
Similarity:126/370 - (34%) Gaps:140/370 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PNIGLYIGGRNAAGQRQGRGWAILPNGDQYDGNYRKGRRHGIGVYVFKDGSRY-----------Y 75
            |:....:.|..:.|...|:|..|..:|.:|:|::.|......|||.:.|||.|           :
  Rat   133 PSASTSLQGMFSEGLMHGQGTYIWADGLKYEGDFVKNIPMNHGVYTWPDGSTYEGEVVNGMRNGF 197

  Fly    76 GQYRC-------------GKRCGR-------------------------GIFIYPDGSVYEGNWR 102
            |.::|             |||.|:                         ||..|..|::|||.|.
  Rat   198 GMFKCGTQPVSYIGHWCHGKRHGKGSIYYNQEGTSWYEGDWVYNIKKGWGIRCYKSGNIYEGQWE 262

  Fly   103 KNLKHGKGRYKYV-NGDNYSGDWFK---------------------------------GQRHGVG 133
            .|::||:||.::: ..:.|:|.|.|                                 |.|||.|
  Rat   263 NNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIGAFVNGFRHGQG 327

  Fly   134 IYHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTILHG-IWDNLYPSGPAVFSFNNRY 197
            .:::.||       ...:..|.||.:.|        ..:.|..:| :::.|         |:|.:
  Rat   328 KFYYASG-------AMYEGEWVSNKKQG--------RGRITFKNGRVYEGL---------FSNDH 368

  Fly   198 LLLGYFLPA----SYNMKAISNEDEMEDAEERLEDEMGEAEPMEPTLWFAQEMAVYDFSLLPQEP 258
              :..|..|    ||::      |...|..:|.....|.:...:                  :||
  Rat   369 --IAQFFEAEMDYSYSL------DRRSDISQRSRQARGSSVSAD------------------REP 407

  Fly   259 VPLAISDSELSVCSLSTEPSMRSEEKISWYGEGEEAEGEEGGEME 303
            ..|...|...|...|.:...:.....:..|  .||::.||..::|
  Rat   408 ETLRKLDGSESRSVLGSSIELDLNLLLDMY--PEESQEEEKKQVE 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 8/21 (38%)
MORN 72..93 CDD:197832 11/69 (16%)
MORN 95..116 CDD:197832 9/21 (43%)
MORN 118..137 CDD:197832 9/51 (18%)
Rsph10bXP_006248920.1 PLN03185 86..>200 CDD:215619 18/66 (27%)
PLN03185 158..>421 CDD:215619 63/312 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.