Sequence 1: | NP_609609.1 | Gene: | Rsph1 / 34712 | FlyBaseID: | FBgn0032478 | Length: | 344 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350614.1 | Gene: | MORN3 / 283385 | HGNCID: | 29807 | Length: | 240 | Species: | Homo sapiens |
Alignment Length: | 271 | Identity: | 63/271 - (23%) |
---|---|---|---|
Similarity: | 91/271 - (33%) | Gaps: | 90/271 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 PEEEEDLGPNIGLYIGGRNAAGQRQG-RGWAILPNGDQYDGNYRKGRRHGIGVYVF-KDGSRYYG 76
Fly 77 QYRCGKRCGRGIFIYPDGSV-----------------------------YEGNWRKNLKHGKGRY 112
Fly 113 KYVNGDNYSGDWFKGQRHGVGIYHFNSGK--DGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTI 175
Fly 176 LHGIW-DNLYPSGPAVFSFNNRYLLLGYFLPASYNMKAISNEDEMEDAEERLEDEMGEAEPMEPT 239
Fly 240 LWFAQEMAVYD 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rsph1 | NP_609609.1 | MORN | 51..73 | CDD:280628 | 8/22 (36%) |
MORN | 72..93 | CDD:197832 | 7/20 (35%) | ||
MORN | 95..116 | CDD:197832 | 8/49 (16%) | ||
MORN | 118..137 | CDD:197832 | 6/18 (33%) | ||
MORN3 | NP_001350614.1 | COG4642 | 34..>188 | CDD:332236 | 44/164 (27%) |
MORN 1 | 38..60 | 7/21 (33%) | |||
MORN 2 | 62..84 | 9/21 (43%) | |||
MORN 3 | 91..113 | 0/21 (0%) | |||
MORN 4 | 114..136 | 10/21 (48%) | |||
MORN 5 | 137..159 | 6/21 (29%) | |||
MORN 6 | 160..182 | 6/32 (19%) | |||
MORN 7 | 184..205 | 6/58 (10%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4642 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1309439at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |