DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and MORN3

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001350614.1 Gene:MORN3 / 283385 HGNCID:29807 Length:240 Species:Homo sapiens


Alignment Length:271 Identity:63/271 - (23%)
Similarity:91/271 - (33%) Gaps:90/271 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PEEEEDLGPNIGLYIGGRNAAGQRQG-RGWAILPNGDQYDGNYRKGRRHGIGVYVF-KDGSRYYG 76
            |::.|.|..       |.:...||.| |......|||.|.|.::...:||.|..|: |.|:.|.|
Human     7 PKKSESLWK-------GWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEG 64

  Fly    77 QYRCGKRCGRGIFIYPDGSV-----------------------------YEGNWRKNLKHGKGRY 112
            .::.|||.|.|....||...                             |||:|..:.:.|.||.
Human    65 DWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRM 129

  Fly   113 KYVNGDNYSGDWFKGQRHGVGIYHFNSGK--DGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTI 175
            .|.|||.|.|.|...:.:|.|:....:|.  :||         |...|:.|....:  :.|...:
Human   130 YYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGC---------WERGMKNGAGRFF--HLDHGQL 183

  Fly   176 LHGIW-DNLYPSGPAVFSFNNRYLLLGYFLPASYNMKAISNEDEMEDAEERLEDEMGEAEPMEPT 239
            ..|.| ||:...|..:                                      :.|..|..|||
Human   184 FEGFWVDNMAKCGTMI--------------------------------------DFGRDEAPEPT 210

  Fly   240 LWFAQEMAVYD 250
            .:...|:.:.|
Human   211 QFPIPEVKILD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 8/22 (36%)
MORN 72..93 CDD:197832 7/20 (35%)
MORN 95..116 CDD:197832 8/49 (16%)
MORN 118..137 CDD:197832 6/18 (33%)
MORN3NP_001350614.1 COG4642 34..>188 CDD:332236 44/164 (27%)
MORN 1 38..60 7/21 (33%)
MORN 2 62..84 9/21 (43%)
MORN 3 91..113 0/21 (0%)
MORN 4 114..136 10/21 (48%)
MORN 5 137..159 6/21 (29%)
MORN 6 160..182 6/32 (19%)
MORN 7 184..205 6/58 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.