DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and ALS2CL

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001177636.1 Gene:ALS2CL / 259173 HGNCID:20605 Length:953 Species:Homo sapiens


Alignment Length:216 Identity:56/216 - (25%)
Similarity:84/216 - (38%) Gaps:60/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRNAAGQRQGRGWAILPNGDQYDGNYRKGRRHGIGVYVFKDGSR-YYGQYRC----GKRCGRGIF 89
            |....|:..|:|....|:|..:.||:.:|..||.|:.:....|. .:..|:|    |..||.||.
Human   360 GEWCRGRPHGKGTLKWPDGRNHVGNFCQGLEHGFGIRLLPQASEDKFDCYKCHWREGSMCGYGIC 424

  Fly    90 IYPDGSVYEGNWRKNLKHGKG----------RYKYV------------------NGDNYSGDWFK 126
            .|....||:|.:::.|:||.|          .::|.                  .|:.|.|.|..
Human   425 EYSTDEVYKGYFQEGLRHGFGVLESGPQAPQPFRYTGHWERGQRSGYGIEEDGDRGERYIGMWQA 489

  Fly   127 GQRHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTILHGIWDNLYPS----- 186
            |||||.|:....:|       |..:.|:.::...||..|.  :||         |:||..     
Human   490 GQRHGPGVMVTQAG-------VCYQGTFQADKTVGPGILL--SED---------DSLYEGTFTRD 536

  Fly   187 ----GPAVFSFNNRYLLLGYF 203
                |....:|.|.:.|.|.|
Human   537 LTLMGKGKVTFPNGFTLEGSF 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 6/21 (29%)
MORN 72..93 CDD:197832 9/25 (36%)
MORN 95..116 CDD:197832 8/48 (17%)
MORN 118..137 CDD:197832 9/18 (50%)
ALS2CLNP_001177636.1 PH-like 223..321 CDD:302622
COG4642 358..519 CDD:226989 43/165 (26%)
MORN 1 358..380 6/19 (32%)
MORN 358..378 CDD:280628 5/17 (29%)
MORN 2 381..403 6/21 (29%)
MORN 3 409..431 8/21 (38%)
MORN 4 432..452 6/19 (32%)
MORN 5 459..479 1/19 (5%)
COG4642 480..>569 CDD:226989 27/96 (28%)
MORN 6 483..505 10/28 (36%)
MORN 7 506..528 7/32 (22%)
MORN 8 529..552 4/22 (18%)
VPS9 834..938 CDD:280383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.