DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and CG30429

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster


Alignment Length:330 Identity:79/330 - (23%)
Similarity:123/330 - (37%) Gaps:92/330 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YIGGRNAAGQ---RQGRGWAIL---------------PNGDQ-YDGNYRKGRRHGIGVYVFKDGS 72
            |.||.:.:|.   .:.:||.:.               |.|.. |:|::...:|.|:|..:.|.|:
  Fly    26 YPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWVMNKRQGVGSMLRKRGT 90

  Fly    73 R----YYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVG 133
            .    |.|::....:||.|...|.||.||.|.|.||.:||.|...|.:|:.|:|:|....|||:|
  Fly    91 EVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNIYAGEWETDFRHGLG 155

  Fly   134 IYHFNSGKDGCCLSVRMKATWNSNMRTGP---FELYIGNEDKCTILHGIW--DNLYPS----GPA 189
            :..:.:|.       |.:..:....:.|.   :.::.|...|     |:|  |||..|    .|.
  Fly   156 VMFYANGN-------RYEGHFARGYKNGEGVFYHMHTGQIQK-----GMWENDNLKTSVVQDEPK 208

  Fly   190 VFSFNNRYLLLGYFLPASYNMKAISNEDE-MEDAEERLEDEMGEAEPMEPTLWFAQEMAVYDFSL 253
            :   ....::..|.:|.:|    :...:| |.|..:|.:                      |||.
  Fly   209 I---RCNAVITSYPIPRNY----LKYPNEIMRDLFQRHK----------------------DFSN 244

  Fly   254 LP----QEPVPLAISDSELSVCSLSTEPSMRSEEKISWYGEGEEAEGEEGGEMECFPCECDLTDV 314
            .|    .:.|.||.........  |.|....|...:..|...|            |.|.||..:|
  Fly   245 KPHRRFNDRVSLAFIHHHRQYA--SCEERFASPTIVDLYPRAE------------FGCTCDCENV 295

  Fly   315 SEVET 319
            :..||
  Fly   296 ARNET 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 7/21 (33%)
MORN 72..93 CDD:197832 6/24 (25%)
MORN 95..116 CDD:197832 10/20 (50%)
MORN 118..137 CDD:197832 7/18 (39%)
CG30429NP_726512.1 COG4642 59..194 CDD:226989 41/146 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464993
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23084
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.