DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and Pms2

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_036020772.1 Gene:Pms2 / 18861 MGIID:104288 Length:875 Species:Mus musculus


Alignment Length:406 Identity:84/406 - (20%)
Similarity:132/406 - (32%) Gaps:157/406 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EMSEEDLSAPEEEEDLGPNIGLYIGGRNAAGQRQGRGWAILPNGDQYDGNYRKGRRHGIGVYVFK 69
            |.|||:  ...||..|...|.....|....|..:|.|:|:...|:.|.|.:.:|..||.|.|::.
Mouse    65 EQSEEE--TQYEEPILTKLIVESYEGEKVRGLYEGEGFAVFQGGNTYHGMFSEGLMHGQGTYIWA 127

  Fly    70 DGSRY----------------------------------YGQYRC-------------GKRCGR- 86
            ||.:|                                  :|.::|             |||.|: 
Mouse   128 DGLKYEGDFVKNIPMNHGVYTWPDGSTYEGEVTNGMRNGFGMFKCGTQPVSYIGHWCHGKRHGKG 192

  Fly    87 ------------------------GIFIYPDGSVYEGNWRKNLKHGKGRYKYV-NGDNYSGDWFK 126
                                    ||..|..|::|||.|..|::||:||.::: ..:.|:|.|.|
Mouse   193 SIYYNQEGTSWYEGDWVYNIKKGWGIRCYKSGNIYEGQWENNMRHGEGRMRWLTTNEEYTGHWEK 257

  Fly   127 ---------------------------------GQRHGVGIYHFNSGKDGCCLSVRMKATWNSNM 158
                                             |.|||.|.:::.||       ...:..|.||.
Mouse   258 GIQNGFGTHTWFLKRIPNSQYPLRNEYIGEFVNGFRHGQGKFYYASG-------AMYEGEWASNK 315

  Fly   159 RTGPFELYIGNEDKCTILHG-IWDNLYPSGPAVFSFNNRYLLLGYFLPASYNMKAISNEDEMEDA 222
            :.|        ..:.|..:| :::.|         |:|.::...:.....|:...    |...||
Mouse   316 KQG--------RGRMTFKNGHVYEGL---------FSNDHIAQFFETEMDYSQSL----DRWSDA 359

  Fly   223 EERLEDEMGEAEPMEPTLWFAQEMAVYDFSLLPQEPVPLAISDSELSVCSLSTEPSMRSEEKISW 287
            .:|.....|           :...||       :||..|...|...|...|.|...:.....:..
Mouse   360 SQRSRQPRG-----------SSVSAV-------REPETLRKLDGSESRSVLGTSIELDLTLLLDM 406

  Fly   288 YGEGEEAEGEEGGEME 303
            |  .||::.||..::|
Mouse   407 Y--PEESQEEEKKQVE 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 9/21 (43%)
MORN 72..93 CDD:197832 10/92 (11%)
MORN 95..116 CDD:197832 9/21 (43%)
MORN 118..137 CDD:197832 9/51 (18%)
Pms2XP_036020772.1 PLN03185 106..>405 CDD:215619 65/344 (19%)
vATP-synt_E 782..>829 CDD:419987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.