DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and rsph1

DIOPT Version :9

Sequence 1:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_009302854.1 Gene:rsph1 / 100003444 ZFINID:ZDB-GENE-041008-22 Length:232 Species:Danio rerio


Alignment Length:232 Identity:80/232 - (34%)
Similarity:113/232 - (48%) Gaps:33/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DLSAPEEEEDLGPNIGLYIGGRNAAGQRQGRGWAILPNGDQYDGNYRKGRRHGIGVYVFKDGSRY 74
            |:.:.|.:|:.| ::|.|.|.||.||:|.|:|.|:|||||.|.|.|..|:|...|.|.||:|:||
Zfish     3 DVGSEEFDEERG-SLGEYEGDRNEAGERHGQGKAVLPNGDTYQGAYENGKRSSQGTYKFKNGARY 66

  Fly    75 YGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVGIYHFNS 139
            .|::....:.|.|.|.|||||.|||.|..:.:.|.|.|.|.|||.|.|:|...||||.|.|.::.
Zfish    67 TGEWYMNLKHGEGTFYYPDGSKYEGTWVDDQRQGLGVYTYPNGDTYDGEWLHHQRHGQGAYTYHD 131

  Fly   140 GKDGCCLSVRMKATW-NSNMRTGPFELYIGNEDKCTILHGIWDNLYPSGPAVFSFNNRYLLLGYF 203
                  ...:...|| ...|.:....:|:.:.     ..|.:.|..||||..:.|:......|.:
Zfish   132 ------TGSQYVGTWIMGKMESAGELIYLNHR-----YQGNFINNNPSGPGKYVFDIGCEQHGEY 185

  Fly   204 LPASYNMKAISNEDEMEDAEERLEDEMGEAEPMEPTL 240
            |                    ::|...|:||..||.:
Zfish   186 L--------------------QIEQVKGDAEEEEPAM 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_609609.1 MORN 51..73 CDD:280628 10/21 (48%)
MORN 72..93 CDD:197832 7/20 (35%)
MORN 95..116 CDD:197832 9/20 (45%)
MORN 118..137 CDD:197832 10/18 (56%)
rsph1XP_009302854.1 COG4642 19..>143 CDD:332236 58/129 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4563
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 1 1.000 - - FOG0009514
OrthoInspector 1 1.000 - - oto41438
orthoMCL 1 0.900 - - OOG6_103378
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7247
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.