DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5287 and Y60A3A.8

DIOPT Version :9

Sequence 1:NP_609608.1 Gene:CG5287 / 34711 FlyBaseID:FBgn0032477 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_507862.2 Gene:Y60A3A.8 / 180308 WormBaseID:WBGene00013359 Length:372 Species:Caenorhabditis elegans


Alignment Length:95 Identity:20/95 - (21%)
Similarity:40/95 - (42%) Gaps:20/95 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 STPQLFHFV---PCPRHRLPKYDSKTDLL-------HISTTEFRLE-----DLNAPGRLMVTVLR 341
            |||...|.|   .|..:.:..|....|.:       :|...:.::|     .|..||:....:.:
 Worm    44 STPNHLHDVAIHTCENYTVFTYSDSPDTVFTLKYFKNIGENDLKIEYSESPVLFVPGKNQKFIFK 108

  Fly   342 -NLRLISWHTKADGVVRTNNFTLINFVLVV 370
             ::.:.:..::||.|    :|.|.:|.|::
 Worm   109 TSIHVENLASEADDV----DFALDDFKLLL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5287NP_609608.1 GT_GPT_euk 24..320 CDD:133465 8/37 (22%)
Y60A3A.8NP_507862.2 FTH 169..>262 CDD:366829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0472
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.