DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg7 and Y60A3A.8

DIOPT Version :10

Sequence 1:NP_609608.1 Gene:Alg7 / 34711 FlyBaseID:FBgn0032477 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_507862.2 Gene:Y60A3A.8 / 180308 WormBaseID:WBGene00013359 Length:372 Species:Caenorhabditis elegans


Alignment Length:95 Identity:20/95 - (21%)
Similarity:40/95 - (42%) Gaps:20/95 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 STPQLFHFV---PCPRHRLPKYDSKTDLL-------HISTTEFRLE-----DLNAPGRLMVTVLR 341
            |||...|.|   .|..:.:..|....|.:       :|...:.::|     .|..||:....:.:
 Worm    44 STPNHLHDVAIHTCENYTVFTYSDSPDTVFTLKYFKNIGENDLKIEYSESPVLFVPGKNQKFIFK 108

  Fly   342 -NLRLISWHTKADGVVRTNNFTLINFVLVV 370
             ::.:.:..::||.|    :|.|.:|.|::
 Worm   109 TSIHVENLASEADDV----DFALDDFKLLL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg7NP_609608.1 GT_GPT_euk 24..320 CDD:133465 8/37 (22%)
Y60A3A.8NP_507862.2 FTH 169..304 CDD:396410
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.