DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5287 and DPAGT1

DIOPT Version :9

Sequence 1:NP_609608.1 Gene:CG5287 / 34711 FlyBaseID:FBgn0032477 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_005271479.1 Gene:DPAGT1 / 1798 HGNCID:2995 Length:434 Species:Homo sapiens


Alignment Length:430 Identity:223/430 - (51%)
Similarity:286/430 - (66%) Gaps:37/430 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IAINAAISGAAYCMTVRMIPRFREMFIKANLFGNDLCKKDKPQVPESFGVLIGCVFLVSLFLFIP 70
            :.||..:|...:..||.:||.||..||.|.|.|.||.|..:.|:|||.||:.|.|||:.||.|||
Human    11 LLINLIVSLLGFVATVTLIPAFRGHFIAARLCGQDLNKTSRQQIPESQGVISGAVFLIILFCFIP 75

  Fly    71 IPFAFDEAAATDAITGGKPDTFPHDKFVELIAALLSICCMIFLGFADDVLDLRWRHKLLLPTIAT 135
            .||       .:.....:...|||.:||.||.|||:||||||||||||||:|||||||||||.|:
Human    76 FPF-------LNCFVKEQCKAFPHHEFVALIGALLAICCMIFLGFADDVLNLRWRHKLLLPTAAS 133

  Fly   136 LPLLMVYYVNYNSTTVIMPNFARNLIGTSLNIGALYYVFMGMLAVFCTNAINILAGINGLEVGQS 200
            |||||||:.|:.:||:::|...|.::|..|::|.||||:||:|||||||||||||||||||.|||
Human   134 LPLLMVYFTNFGNTTIVVPKPFRPILGLHLDLGILYYVYMGLLAVFCTNAINILAGINGLEAGQS 198

  Fly   201 FIIAGSILVFNAIELLLGHQVDSHIFSIYFMLPFLATTLALWKFNKYPSQVFVGDTYCYFAGMTF 265
            .:|:.||:|||.:| |.|...|.|:||:|||:||..|||.|...|.|||:||||||:||||||||
Human   199 LVISASIIVFNLVE-LEGDCRDDHVFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTF 262

  Fly   266 AVVGILGHFSKTLLLFFLPQILNFLYSTPQLFHFVPCPRHRLPKYDSKTDLLHISTTEFRLEDLN 330
            ||||||||||||:||||:||:.|||||.|||.|.:||||||:|:.:.||..|.:|.::|:.:.|:
Human   263 AVVGILGHFSKTMLLFFMPQVFNFLYSLPQLLHIIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLS 327

  Fly   331 APGRLMVTVLRNLRLISWH---TKADGVVRTNNFTLINFVLVVFGPVHERVVTQMLM-------- 384
            ..|..::.|..:|:|::.|   |:.......||.||||.:|.|.||:|||.:|.:|:        
Human   328 FLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHERNLTLLLLLLQVRMGI 392

  Fly   385 ------------------GFQVLCTLIALTIRYPLANYFY 406
                              ..|:|.:.|..:|||.|...||
Human   393 EFIPPCLPFCVILTPVHFSLQILGSAITFSIRYQLVRLFY 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5287NP_609608.1 GT_GPT_euk 24..320 CDD:133465 185/295 (63%)
DPAGT1XP_005271479.1 GT_GPT_euk 29..317 CDD:133465 185/295 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144443
Domainoid 1 1.000 250 1.000 Domainoid score I2125
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1058
Inparanoid 1 1.050 443 1.000 Inparanoid score I1657
Isobase 1 0.950 - 0 Normalized mean entropy S726
OMA 1 1.010 - - QHG53672
OrthoDB 1 1.010 - - D1079130at2759
OrthoFinder 1 1.000 - - FOG0004088
OrthoInspector 1 1.000 - - oto88448
orthoMCL 1 0.900 - - OOG6_101483
Panther 1 1.100 - - LDO PTHR10571
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2836
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.